Conserved Protein Domain Family
PRK08418

?
PRK08418: PRK08418 
chlorohydrolase; Provisional
Statistics
?
PSSM-Id: 181419
View PSSM: PRK08418
Aligned: 29 rows
Threshold Bit Score: 534.934
Threshold Setting Gi: 208434213
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32267263    2 LHIWGAQEAFICDENFSILHNGAIAFEenkDKILAVGDYEALCSQFPNAK-THFFPQGILLPSLINAHIHFEFGSHLAQF 80
gi 34557817    2 IHILGAERVLLCDEEFRLLSKGAVAFLg--DKILAVDSYEKLQKRYPEAL-AEYHPQGILLPGLINAHLHLEFSANQTTL 78
gi 157736750  20 MKAISASYVVTCDENNRIIKDGAVVFD---DKLIEIDTLFEIKNKYPNLEiKELEENSILMPGLVNSHIHLEFSANTTTL 96
gi 152992630   1 MKIIVADHIYTPN---GFIENQAVAFD---EQIRGIGPLESLLTIYPNADiIRTAPYSVIYPGFINTHVHLEFSANKTSL 74
gi 152990178   1 MRIIKPFAILTPQ---TIIQDKAVAFD---KKIEAIDTVENLIKKYPNAA-VEHDENSLLLPGFANPHLHLEFSANKATL 73
gi 154147920   1 MKILLAKYILTCDENFTILHDKAVVFD---DKIIEICDFKNAVKKYGNEAeILDYRNDFLMPAFINPHVHLEFSANRTTL 77
gi 118475030   1 MKIIKAKYILTCNDNFDILEDSAIAFD---EHIKQISSFDNLIKIYPDAQ-IMDFKDDIAMPAFINPHVHLEFSSNVSSL 76
gi 78776885    1 MQIITPEYILTPQ---NLLRNFSVAFD---KTIHKIAPLEELKILFPDAKiIKLQKNSLLMPGLINAHVHVEFSANKTEL 74
gi 291277639   1 MQVIGASKIFLCDEKFHILENGGIAFEk--GKIKDLGDYQKLCMQYGGGE---FFENSVLLPTFTNPHIHFEFSANHANF 75
gi 296272292   1 MKILKASWLICVDENSTIIKDGAILFD---EKIKDFGEIESLKAKYKDLEvEDLGVNTVLMPGLINSHIHLEFSSNSTSL 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32267263   81 CYGDFGAWLDSLMTSRDEVLNSGNSSetIILQDINDQINAGVGSVGAISSYGNDMTALASSPLRVVYFNEAIGSNPSAID 160
gi 34557817   79 LYGGFDRWLSSVITHRDVLMGEGAKE--AMRRALDEVLSSGTTTIGAISSAGLDLEILAHSSLRVLFFNEVIGSNPSAID 156
gi 157736750  97 KYGNFYSWLNSVIKHREDLINKATNE--LISTKLNKIKKTGTTTIGAISSYSFDMEACIKSPINTVFFCEVIGSKADMVD 174
gi 152992630  75 KYGSFMPWLDSVIEHRDDLVNACDNA--MMQKECDEMLRSGITAFGAISSFGTELEVCEKAAQRVVFFNEVIGSNAATAD 152
gi 152990178  74 QYGDFIPWLYSVIRHREDLLPLCDGA--CLEQTLSSIIQTGTTAIGAISSYGEDLQACIDSALKVVYFNEVIGSNAATAD 151
gi 154147920  78 EYGDFLKWLKSVINSRDELSKEAKNA--AIKKQIEILKKSGVGTIGEISSFGIDTEICANSGIRTIFFNEILGSNPNFIN 155
gi 118475030  77 DYGDFIVWLKSVIKTRDNLSEQAKNK--IIKNAITTMLKSGISTIGEISSFGNEAEICADSGARFIFFNEILGSNSENLS 154
gi 78776885   75 SYGDFIPWLYSVLENRETLIEGCKKG--CMREAISCMLESGITTFGAISSHGMDLDVCADAKQNVVFFNELIGSQATMAD 152
gi 291277639  76 LYGSFDKWLDSVMQKREDVLNDNTKA---IKEAIGQQLDSGVGSVGAISSYGDDMEILASCPLKVVFFHEALGSNAAALD 152
gi 296272292  78 SYGNFMSWLNSVIINREALIEKSSTT--LINTKLNEMLKGGTTTIGAISSYGFEIEACTKTPINTVLFSEVIGSKADMID 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32267263  161 FLYAHILERLERAKSL-HSPTFIPAIALHSPYSLHPIMAQKLIDIATKDKLPLSAHFLESAHEREWLTQNSGYFKTFFQR 239
gi 34557817  157 FLWEDFLGRLKRSEEF-KSSRFTPLVAIHSPYSVHPFLIKRALLEAKRLGGVVSTHFMESKEEREWLEESRGFFGDFFAR 235
gi 157736750 175 TLFADFRSRLNNAKKF-ASKNFIPAIAIHSPYSVHPFLVREALNVARDENLAVSSHFLESQEEFEWLHKDEGSFLEFFKN 253
gi 152992630 153 MLYGDFLERVKASQSCdESAKITPAVAIHSPYSVHPIILQKAVTLAKQNKMPLTAHFLESQVERQWLEEGEGEFKSFFEK 232
gi 152990178 152 VMYASFLERFHQSKKH-ENERFKAAVAIHSPYSVHYILAKRALDIAKKYGSLVSVHFMESRAEREWLDKGSGEFAKFFKE 230
gi 154147920 156 QSWEKFLTRFEYSKNF-TNDMFIPAISVHSPYSTAEILTKKACDFARKNNLLMSTHFLESGYEREWLDGGNNDFKKYLLK 234
gi 118475030 155 DNWDKFITKFNNSLKF-KSDKFIPAVSIHSPYSTHPKLAKRVLDLARQNNLLVSTHFLESEHEKRWLENGDGEFKIWLGN 233
gi 78776885  153 ALFADFLARLDASKSV-NREGFYPAIAIHSPYSVHPILIKKALQIVKNENLKLTAHFMESSAEREWLDKSEGDFKEFFEK 231
gi 291277639 153 FLHQNFLQRLEHSKAL-QSESFFPGIALHSPYSVHFVFAKKLLELARKENYPTSVHFLESSIEREWLEHSSGWFLEFFKK 231
gi 296272292 156 TLFTDFKARLESAKKS-ASKSFIPAIAIHSPYSVHPFLVRESLRLAKEENLNVSAHFLESIEEFDWLHKDEGKFLEFFKN 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32267263  240 FFKIENPqsFYSPQSFLDMLSPLrdtPLS-LTHCLYIKEEEAKMIESLQASIITCPRSNRLLNNAFFTRSLLRNKKIPLA 318
gi 34557817  236 FFGGVKPkaLSTPLEFLELLEGQ---RVM-LVHGVQMNEEELAKAASLGASLASCPRSNRLLGGELLDISKVKKAGIPFL 311
gi 157736750 254 FLNQEKA--TSKPMEFLGLFSKV---KNLsFTHCVEASDDDLEKIKDLGASINHCVTSNRLLNNTKLDLDRL--KDIPFT 326
gi 152992630 233 YFSTSTP--VTNIQEFMHAFDTY---PTH-FAHAVQATEEELEYLSQKGHSIAHCPRSNRYLGCGRLPIETLQKYALPYS 306
gi 152990178 231 FLNQTRP--VNDTKSFLELFKEL---HTL-FVHMVWANEEEIQTIASYNAHIIHCPISNRLLGNGVLDLEKI--KSIPYA 302
gi 154147920 235 FSENPKP--FYTPKSFIEHFKEL---RTL-FTHCVFVDD--FSVFDVKFHAITHCAVSNRFLSAKTLDLNKIRASNINYN 306
gi 118475030 234 FSKDVKP--FYTPKSFLNYFDGI---RTL-FTHCVFADEY-FEYFDKNLHCITTCPVSNRLLSNK-LNLKKVFDSNISLN 305
gi 78776885  232 LLKQNSA--TCGASEFLEHFNEQ---QTL-FTHVVKANEEELLSIKKGNHTIIHCPISNRLLGNGALDLNEINKKNINWI 305
gi 291277639 232 TLQVKNPrsLYEIEEFIELFLGL---DTL-FVHCLHATESEISKLTQ-TGYIITCPRSNRLLNNKLFPLQQAPIHKILF- 305
gi 296272292 235 FLGQEKS--ATKPMEFLQQFSGI---KNLsFTHCVEASDNDLEKIKELGAVINHCPTSNRVLNNKRLEIEKL--KDITYA 307
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32267263  319 LGTDGKSSNNNVNLLDELRTSLYAYPQEDILALAKSLILSATLYGAKTLGLNNGTLSEGKNVDFAIFEFsQplfqtHQSH 398
gi 34557817  312 LATDGLSSNTSLSLLEELRIALFAYAKEPLESWARELVLSVTKRAAYALGLESGELREGLKADLALFEL-E-----GIGE 385
gi 157736750 327 IGTDGLSSNNSLSMFDELRNALMAHYDKNVVEFSKILLKAATFNGSRALGLNKGVLKESFDADMISFKLpN-----KIED 401
gi 152992630 307 VATDGLSSNDSLSIFDEFRAAIMLHHQAPIHILAERLIRASTQDAAEILGLNCGKIEVGALADLVVLTLpA-----MPQS 381
gi 152990178 303 IATDGLSSNYSLNMYEELKAALFVHPNKEATTFAKELIIRATKAGYDALGFEGGEIAVGKDADMQLIDLpE-----GLTN 377
gi 154147920 307 IATDGLSSNISLNFLDELRANLFIHDNENLCDFARELLQNSTSETAKFLGLDLGEISIGKIADFSIFNG-F-----EVSD 380
gi 118475030 306 IATDGLSSNISLNFFDELRAALFTHSDFDLLELSKILLFSSTNAVAKSLGLELGVIKSGKIADISIIKG-I-----SVNS 379
gi 78776885  306 CATDGLSSNYKLDLFEEMKCALFMHSNMPLLPLAKQLISSVTKDAALALGINSGEIEEGKNADMLVLDLdK-----EPN- 379
gi 291277639 306 -ATDGKSSNNNLNFLEELRTALFAYANEDLENLAKNLLLSATRYGAESLRLNSGSLCKGLDADFSIFEIe------QITQ 378
gi 296272292 308 IGTDGLSSNNSLQMFDELRNALMIHTNLNINELSVDLIKAATLNGAKALGLNKGRIKQGCDADIIVCKLpD-----EVKN 382
                        410       420
                 ....*....|....*....|....*.
gi 32267263  399 PNQSPLHFILHATKPTHLFINAKAVL 424
gi 34557817  386 CTQEALQWILHAKKVKTLYIEGKKVE 411
gi 157736750 402 INDICMQIILHTKFVDDVIIGGE-YV 426
gi 152992630 382 KEEVALWSIIHTKQVSQVYIEGEQYV 407
gi 152990178 378 VEDLYLHVILHTTKPKKVYIQGEEHV 403
gi 154147920 381 ENQIALQIILQNKNVKKLFIKGKLCE 406
gi 118475030 380 KEQLVLEILLHTKFVKKLYIKGNECL 405
gi 78776885  380 -DELAIHLILHRYNISQIYINGKLIP 404
gi 291277639 379 SKQAPLQFLLQAQKAKALFINGKKIL 404
gi 296272292 383 EEELCTQIILHTKEVQNVYINGEKHV 408
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap