Conserved Protein Domain Family
PRK08417

?
PRK08417: PRK08417 
dihydroorotase; Provisional
Statistics
?
PSSM-Id: 236262
View PSSM: PRK08417
Aligned: 11 rows
Threshold Bit Score: 540.06
Threshold Setting Gi: 153951235
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 34557819    1 MRIREGKIVEIQKSIlpeKGEEVVLAEGLSLLPAMVDLNVRVANDSLTGKNLATLAKKAAKGGVGSLALMpDCSPSLDNE 80
gi 121612810  16 IEIKEGKITNIGSNL---QGEEILDAKGMTLLPSFVDLCVSLKNDKFSLANLELLENECLKGGISSIVLR-DCMDFDEES 91
gi 57238067   16 IEIKEGKITNIGSNL---QGEEILDAKGMTLLPSFVDLCVSLKNDKFSLANLELLENECLKGGISSIVLR-DCMDFDEES 91
gi 78777103   19 VRVEDGIIAEIGTDI---KGENIVDAKGCYLLPLLVDINIKTPDSNLNAKNIKIVSTEALAGGIGHIVLNpDSTPAIDNE 95
gi 291277637  19 LRITDEIISEISPTLtpqENEEVLDCTGKDLLPALIDIGIYPKNKSLSSSTLSSLNAKCLQGGVGSALLYgDLHPLCNDA 98
gi 222824203  16 LKIEDGKITQIANDLn--DDEYIVDIKGKTLLPSFIDLNVSLLDNEFSIDKLYNLEKACLKGGVGTIVLK-DSLEANTQG 92
gi 153951235  16 IEIKEGKITNIGSNL---QGEEILDAKGMTLLPSFVDLCVSLKNDKFSLANLELLENECLKGGISSIVLR-DCMDFDEES 91
gi 152990858  19 ILIKNGRIEKIGTGF---NDEEVIDCSGKMVMPGLIDLNVRVHDDKISSSNLKKCIDESRKGGVTTIALVpDSEPPICNE 95
gi 32267265   19 LRAQNGLITDIGS-LqplKDEDIYDAKDRILFPAMIDLNVAPKSLSLSRKNLLSLAQKALKGGAGSILLYpHTTPSCSEN 97
gi 218562807  16 IEIKEGKITNIDSNL---QGEEILDAKGMTLLPSFVDLCVSLKNDKFSLANLELLENECLKGGISSIVLR-DCMDFDEES 91
gi 157415459  16 IEIKEGKITNIGSNL---QGEEILDAKGMTLLPSFVDLCVSLKNDKFSLANLELLENECLKGGISSIVLR-DCMDFDEES 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 34557819   81 AAIELLNSYKGElpASIFPIASATkKEDGKLSDLSILHKMGCRGIAIES-SLDGNLSRRVCEYSLMMKAPIFCRCEDVSL 159
gi 121612810  92 FALFLQNLAQRK--MQIFSSVRVK-DTNGKLKNLATLLNKGACALELDS-SLDANTLKVSSQYAFMKDSPIFVRCYDKDF 167
gi 57238067   92 FALFLQNLAQRK--MQIFSSVRVK-DTNGKLKNLATLLNKGACALELDS-SLDANTLKVSSQYAFMKDSPIFVRCYDKDF 167
gi 78777103   96 IVLEFAQNGLHElrGAKVDLMINTlKEDTTLSNIAILLKRGAISPYMST-IAKNDVAIKIAQYAQMYGVTIFCKAEDNSL 174
gi 291277637  99 NTLELIGFINSTlaLNVFSSIHAF-APDGRIADIASLKSCGAKALHCKSqDLEGYNLLTLLNYAKMLNLPLILMPHDAQL 177
gi 222824203  93 YALYFDKLKSLD--VNILPTINVL-DKTEKLKNIATLIDMGAKGLELSS-TLGANYLRQCMQYANMKSTPVFLKCFDENF 168
gi 153951235  92 FALFLQNLAQRK--MQIFSSMRVK-DANGKLKNLATLLNKGACALELDS-SLDANILKVSSQYAFMKDSPIFVRCYDKDF 167
gi 152990858  96 ITLDFICSQQEN--EEIVPVILAL-QDKDRLSEISILFKHGAKGIYTTS-DINPYLMARIFEYAKMLQVPLFIEPKNSVF 171
gi 32267265   98 GSIELIKSLNKEspIHLIPAISPL-DSQGKLSDISTLHTNGAKAIFAPS-DIDAHSLMSIAQYAQMLDIPLMCFCQDSSV 175
gi 218562807  92 FALFLQNLAQRK--MQIFSSVRVK-DANGKLKNLATLLNKGACALELDS-SLDANTLKVSSQYAFMKDSPIFVRCYDKDF 167
gi 157415459  92 FALFLQNLAQRK--MQIFSSVRVK-DANGKLKNLATLLNKGACALELDS-SLDANTLKVSSQYAFMKDSPIFVRCYDKDF 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 34557819  160 RGSGVMNDGYLSSRMGLPGIPSLSETKEVAKMAETAIFMRTPVLFQALANERSLRIIErak----------------een 223
gi 121612810 168 DDNGVMNDCEMSFELGLIGMSKIAETSQIAKMKELAKFYKNKVIFDLLSLKDSLVLLD---------------------- 225
gi 57238067  168 DDNGVMNDCEMSFELGLIGMSKIAETSQIAKMKELAKFYKNKVIFDLLSLKDSLVLLD---------------------- 225
gi 78777103  175 ISSGVMLDGDVSSKLGLAGIPDLSEVLHVSRMIEIARHFKIKILFKAIASPRSIYLINkak----------------seg 238
gi 291277637 178 AN-GVIDAGSLGAQMGLPSIPSIAWSKEVAKLGEISRFFCTPMLL-TLADPKSIDYVKffn----------------tqg 239
gi 222824203 169 DDHGVMNDGQTSFELGLIGISNIAEISEVAKMKELVEFYKNKACFNSLAIARSFELLH---------------------- 226
gi 153951235 168 DDNGVMNDCEMSFELGLIGMSKIAETSQIAKMKELAKFYKNKVVFDLLSLKDSLVLLD---------------------- 225
gi 152990858 172 RDVGVMNEGRTSFELGLGGIDNLEEIAEVAKIIEYSEHYGVGVLFKNVSTAKSLERIAk--------------------s 231
gi 32267265  176 AD-GVMNEGILSASLGLPSIPAYSQTKEVAKIAEMFKNMPIKLIFDTLVYPRSFEILQsfraihnktsqknkdsmqfget 254
gi 218562807 168 DDNGVMNDCEMSFELGLIGMSKIAETSQIAKMKELAKFYKNKVIFDLLSLKDSLVLLD---------------------- 225
gi 157415459 168 DDNGVMNDCEMSFELGLIGMSKIAETSQIAKMKELAKFYKNKVIFDLLSLKDSLVLLD---------------------- 225
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 34557819  224 PSLFAEVSIHHLAITEDFCSGFNTGAKIRPPLKSESTRKKLLQLLKEGVVDVVTSLQSEHSLSKKDVAFEEAAFGVDNIE 303
gi 121612810 226 EKDLKLVSIHHLIKDDSACEDFNTAAKLMPPLRSKEDVLALREALKEGKISFLTSLHSAKSISLKDLAFDEAAFGIHSVC 305
gi 57238067  226 EKDLKLVSIHHLIKDDSACEDFNTAAKLMPPLRSKEDVLALREALKEGKISFLTSLHSAKSISLKDLAFDEAAFGIHSVC 305
gi 78777103  239 VNVTCEVSIHHILNSDESCKGFNTTAKLNPPLASKTDMLLLQEALKNSQIDILTTLHQPSSPLRKEVAFYDAAYGCDGLL 318
gi 291277637 240 AQLLLQTSIHHLALEESHIQNYNTKAKIFPPLKNKASREALLQKICDGEIDCITSLQNATYNSHKDQVFELASSGIDTIN 319
gi 222824203 227 -DQYSEISIHHLIKDESACENFNTQAKILPPLRAKNELISLKKLLQDRKITFLSSLHTPS--TKKDLAFDEADFGINAIA 303
gi 153951235 226 EKDLKLVSIHHLIKDDSACEDFNTAAKLMPPLRSKEDVLALREALKEGKISFLTSLHSAKSISLKDLAFNEAAFGIHSVC 305
gi 152990858 232 RKCFAEVSVHHLLLNDESCKEYNTLAKISPPLREEEEREALVQALQAGKIDLLTSLHSPKSNVHKDISFDEAAFGISSIF 311
gi 32267265  255 PQFFTQTSIHHLILDESLCDNYNTAAKLNPPLVEKNAQSKLIEMLQNGYIDTLTSLQCADFNSKKDQVFELASFGVDALE 334
gi 218562807 226 EKDLKLVSIHHLIKDDSACEDFNTAAKLMPPLRSKEDVLALREVLKEGKISFLTSLHSAKSISLKDLAFDEAAFGIHSVC 305
gi 157415459 226 EKDLKLVSIHHLIKDDSACEDFNTAAKLMPPLRSKEDVLALREALKEGKISFLTSLHSAKSISLKDLAFDEAAFGIHSVC 305
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 34557819  304 NHFSLCYTYLIKQGRLSMSDLSRVTAKRAAEILGLESkGYVGVGADADLILVDIKSSKVVEDNfSPYYNSILYGEVERTI 383
gi 121612810 306 EFISLCYTFLIKEGFLNWQELCRFTSKNPSEFLGLNS-GVIEVGKEANLVLFDENEEIFAPKS-SLYSEDKLFGKIKMHI 383
gi 57238067  306 EFISLCYTFLIKEGFLNWQELCRFTSKNPSEFLGLNS-GVIEVGKEANLVLFDENEEIFAPKS-SLYSEDKLFGKIKMHI 383
gi 78777103  319 HAMSLYYTKLVKSKMITMSRLLELCVINPLQAIGQDG-SEIKVGAKASFMLFDPNKKVIIDEKlSLYNGEELYGEIREVF 397
gi 291277637 320 EYFSLLYTYLVRTKIITLAKLSAMTSYHQAKFLNLPC-GELSVGKRADILVADLEQSTICQDNySPYFGQELYGKINHFI 398
gi 222824203 304 MYMSLCFTYLVKEGILTWRELCDFASYNQAQFLGLNK-GKIELGFDADLVVFEENLSFEGE---GLYANDILQGKVEKSF 379
gi 153951235 306 EFISLCYTFLIKEGSLNWQELCQFTSKNSSEFLGLNS-GVIEVGKEANLVLFDENEEIFTPKS-SLYSEDKLFGRVKMHI 383
gi 152990858 312 YYLPLLYTKLVKSNIIRATKLVELTSANPACFIEKRV-GQITPGYEADLVIFDPNAKTKIDT--PALYGEELDGKVEAVI 388
gi 32267265  335 IYFPLLYTYLHKAYNIPLPLISQFTSYTPAQILNLNK-GALQEGKIAQLFVFNPHTRFKVNDMfSPYHQHNLYGNIEAFL 413
gi 218562807 306 EFISLCYTFLIKEGFLNWQELCRFTSKNPSEFLGLNS-GVIEVGKEANLVLFDENEEIFAPKS-SLYSEDKLFGKIKMHI 383
gi 157415459 306 EFISLCYTFLIKEGFLNWQELCRFTSKNPSEFLGLNS-GVIEVGKEANLVLFDENEEIFAPKS-SLYSEDKLFGKIKMHI 383

                 ....*...
gi 34557819  384 IAGETVYK 391
gi 121612810 384 IKGKNILE 391
gi 57238067  384 IKGKNILE 391
gi 78777103  398 ND------ 399
gi 291277637 399 LKGKIYE- 405
gi 222824203 380 IAGKSF-- 385
gi 153951235 384 IKGKNILE 391
gi 152990858 389 KRGSLVRL 396
gi 32267265  414 SNEILYTP 421
gi 218562807 384 IKGKNILE 391
gi 157415459 384 IKGKNILE 391
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap