Conserved Protein Domain Family
PRK08371

?
PRK08371: PRK08371 (this model, PSSM-Id:103385 is obsolete)
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 103385
View PSSM: PRK08371
Aligned: 5 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
14521569    1 MEKPIIVGVGMTPVGEHWRTSLRDLAVEAILKAMDDAGIDK--VDSLYVGNMASGSFVEQENLGALIADWAGLGNIPAVK 78 
18977345   16 MRKAIIVGVGMTPVGEHWRSSLRDLAVEAILNAMDDAGIDK--VDSLYVGNMASGSFVEQENLGALIADWAGLGNIPAVK 93 
14590558    2 NNKVIIVGVGMTPVGEHWRTSLRDLAVEAILKAMDDAGIDK--VDSLYVGNMASGSFIEQENLGALIADWAGLGNIPAVK 79 
57640115    1 MEKPVIIGVGMVPVGEHWRVSLRDMAVEALLNAMDDAGIDK--VDSLYVGNMASGSFIEQENLGALIADWAGLGNIPAVK 78 
119719675   1 MTGVYLVGIGATKIDEHWERPLRDLMLEASLKALRDAGLSKrdVEAIFVGNMSSGYLQGQEHLGSLLATWLGVPGVAANK 80 
14521569   79 VEAACASGGAAVQEGAKAVLSGLEDVVLVVGVEKMTDAWPSDATRYLAYASDAEWELFHGVSFVALNALIMRHYMNTYGY 158
18977345   94 IEAACASGGAAVQEGAKAVLSGLEDVVLVVGVEKMTDAWPSDATRYLGYAADAEWELFHGASFVALNALIMRLYMNTYGY 173
14590558   80 IEAACASGGAAVQEGVKAVLSGLEDVVLVVGVEKMTDAWPSDATRYLAYASDAEWELFHGVSFVALNALVMRYYMNTYGY 159
57640115   79 VEAACGSGGAAVQEGAKAVMAGLEDIVAVVGVEKMTDAWPSDATRYLAYAADAEYELFHGASFVALNALIMRLYMKTYGY 158
119719675  81 VEAACGSGGAAFHNAFLAVKSGLYDCVLAVGVEKLTDATTPDATSALIMAEDQEYVAFAGFSFVALNALVYKAYMKKYGA 160
14521569  159 TEEDLALFAVNAHANGAKNPYAMFKRPITVETVMKSPYIADPLKLFDASPVCDGAAAVIITIPEKAKELGIPKDKWVEIA 238
18977345  174 KEEDLALFAVNAHANGAKNPYAMFKKPITVETVMKSPYIADPLKLFDASPVCDGAAAVIITTPEKAKELGIPKDKWIEIA 253
14590558  160 TEEDLALFAVNAHANGAKNPYAMFKKPITVETVMKSPYIADPLKLFDASPVCDGAAAVIITTPEKAKELGVPKDKWVEVA 239
57640115  159 TEEDLAHFAVNAHANGAKNPYAMFKRPITVDTVLKSPYVADPLKLFDAAPMCDGAAAVIITSKEKAKELGVPKDKMVELA 238
119719675 161 KQEDIALFAVHDHKYAVNNPLAQYPRAVTLEEVLSSPMVADPLRLLESAPLGDGAAAALLCSEKKLKE--VEKDVVIEVV 238
14521569  239 GMGRAIDTINLANREDLLTLKAAKIAAEKAYKMAKVEPKDIDFFEVHDAFTVMAALSLEALGVAEKGEGAKLAKEGQIAI 318
18977345  254 GMGRAIDTINLANREDFLTLKAATIAAERAYKMAGVKPEDVDFFEVHDAFTVMAALSLEALGVAKKGEGAKLAIEGQIAI 333
14590558  240 GMGRAIDTINLANREDLLTLKAAKIAAEKAYKMAHVEPKDIDFFEVHDAFTIMAALSLEALGVAEKGKGAMLAKEGQIAI 319
57640115  239 GFWRAIDTINFANREDFLTLKAAKVAAEKAYKMAGVTAKDIDFFEVHDAFTVMAALSLEALGVAEKGKGAMLAKEGQIAI 318
119719675 239 GSALATDVLSLHDRADLTTLSATVKASRKAYAMAGIEPKDVDVLEVHDAFTVLGVIHLEDLGFAEKGAGWKLLKEGQLEK 318
14521569  319 DGDYPIQTMGGLKARGHPVGATGVYQTVESVLQIRGEAPNGIQVPDAEIGLTQNIGGTGSNITVTILRRV 388
18977345  334 DGDYPIQTMGGLKARGHPVGATGVYQVVEAVLQLRGEAPDGIQVPDAEVGLTQNIGGTGSNITVTVLRRV 403
14590558  320 DGDYPIQTMGGLKARGHPVGATGVYQAVEATLQLRGEAPNGIQVPDAEVGLTQNIGGTGSNITVTIFRRV 389
57640115  319 DGDYPIQTMGGLKARGHPVGATGVYQTVEAVLQLRGEAPEGIQVPDAEVGLTQNIGGTGSNITVNVLRRV 388
119719675 319 DGDLPTNTMGGLKARGHPVGATGIYQIYDIAVQLRGEAGKN-QVDGAEVGLAQNVGGVGGTVSVNILKRV 387
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap