Conserved Protein Domain Family
PRK08313

?
PRK08313: PRK08313 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 181378
View PSSM: PRK08313
Aligned: 37 rows
Threshold Bit Score: 553.185
Threshold Setting Gi: 11497750
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
256392278   1 MGNRCAVIGVGQTEYRTKRADVSLAGLVREAAARALADAGLTFADIDSVVLGKAPDMFEGVATPELYLADALGAAGKPML 80 
290962781   2 SKEPVAVVGVGQTKHVAARRDVSIAGLVREAARRALDDAELTWADVEAVVIGKAPDFFEGVMMPELYLADALGAVGKPMM 81 
145595169   1 -MRRAAVLGTGQTHHQTRRTDVSMAGLCREAIDRALADAGLDWPQIDAVVLGKAPDLFEGVMMPELFLADALGAAGRPLL 79 
169627936   1 MSRGVAVVGVGQSK-QAKKREVTIAALVREAVDGALADAELTFGDIDAIVLAKTPDLFDGVMNPELYLADAIGARGLPVT 79 
119716959   2 TKQPAAVIGVGQTHHRAKREDVSMAGLCREAIDRALLDANLSLDDIDAIVVGKAPDLFEGVMMPELFLAEALGAVGKPLL 81 
271963024   1 MGNPCAVIGVGQTHYTTKRRDVSIAGLVREAALRALQDAGLTWKDIDAVVIGKAPDLFEGVMMPEAYLADALGAAGKPMM 80 
159038414   1 -MRRTAVLGTGQTQHQTRRTDVSMAGLCREAIDRALADAGVDWPQIDAVVLGKAPDLFEGVMMPELFLADALGAAGRPLL 79 
29827783    2 SKEPVAVVGIGQTRHVAARRDVSIAGLVREAAQRALLDAELTWADIDAVVIGKAPDFFEGVMMPELYLADALGAVGKPML 81 
300784461   2 TKQLTAVLGTGQTHHRAKRQDVSMPGLLREAIDRAMTDAQVEWADIDAVVLGKAPDLFEGVMMPELFLADSLGATGKPLL 81 
182440628   2 PKEPVAVVGIGQTKHVAARHDVSIAGLVREAAVRALADAGLAWSDIDAVVIGKAPDFFEGVMMPELYLADALGAVGKPML 81 
256392278  81 RVHTAGSVGGSTALVGTSQVQAGVHERVLVVAFEKQSESNATWALSTHSPFSASLVVGAGGYFAPYIRAYIRRSGAPANI 160
290962781  82 RVHTAGSVGGSTALVAASLVAARVHGTVLTLAFEKQSESNAMWGLSLPIPFQQPLLAGAGGFFAPHVRAYMRRSGAPDTV 161
145595169  80 RVHTAGSVGGATAVVATSLVRAGVHNRVLAVAFEKQSESNAMWALSIQPPFTAPIGAGAGGYFAPHVRAYIRRSSAPEHV 159
169627936  80 RVFTGGSVGGHAAIYAAHLIQARLAGRVLVVAYSKESEGNFTWALSRPLPFSAQLGAGAGGHFAPVIREYIRRSHAPEHI 159
119716959  82 RVHTAGSVGGSTAIVAASLVQAGVHKRVLTVAFEKQSESNAMWALSVPLPFNMPVHAGAGGYFAPHVRSYIRRSEAPTHV 161
271963024  81 RVHTAGSVGGSTALVGASLIQGGVHDRVLVVAFEKQSESNATWALSTHPPFSASLVVGAGGYFAPHIREYIRRSGAPEHI 160
159038414  80 RVHTAGSVGGATAIVATSLVRAGVHHRVLAVAFEKQSESNAMWALSIQPPFTAPIGAGAGGYFAPHVRAYIRRSHAPEHI 159
29827783   82 RVHTAGSVGGSTALVATNLIAGRVHGTVLTLAYEKQSESNAMWGLSLPIPFQQPLLAGAGGFFAPHVRAYMRRSGAPDTV 161
300784461  82 RVHTAGSVGGSTALVAASLIQAGVHHRVLTVAYEKQSESNAMWGLSILPPFQMPVGAGAGGYFAPHVRSYIRRSGAPEHV 161
182440628  82 RVHTAGSVGGSTALVAANLVAARVHRTVLTLAFEKQSESNAMWGLSLPVPFQQPLLAGAGGFFAPHVRAYMRRTGAPDEV 161
256392278 161 GMMVAVKDRINALRNPYAHLKIPNIDLAMVEESMMLWDPIRYLETCPSSDGAVAMVLASERAAQassaATGRRPAWVHGA 240
290962781 162 GSLVAYKNRRNALKNPYAHLHEHDITLEKVQASPMLWDPIRYSETCPSSDGAVAMVLTDRAGAA----RAPRPVAWMHGG 237
145595169 160 GALVAVKDRRNGALNPYAHLRQPEITLASVQASQMLWAPIRYDETCPSSDGACAMVIGDQAAAE----ASERPVAWIRAT 235
169627936 160 GWQVAVNHRLNATRNPYAHIHKPDITIEEVRNSPMLWDPIRFLESCPSSDGSCAVVISSEMHAR----LAPRPPAWIHGT 235
119716959 162 GAIVAAKDRQNALKNPYAHLKNPDTTVESVLASQMLWDPIRYDETCPSSDGACALVIVDEDTAA----ASPNPA-WIHGT 236
271963024 161 GHLVAVKDRRNALKNPYAHLRIPGIDLKMVESTPMLWEPIRYLDTCPSSDGACAMVLSARDKI-----TDSTPA-WVLGT 234
159038414 160 GALVAVKDRRNGALNPYAHLRQPDITLESVRASRMLWDPIRYDETCPSSDGACAMVIGDQAAAE----ASERPVAWIRAT 235
29827783  162 GSLVAYKDRRNALKNPYAHLHEHDITLEKVQASPMLWDPIRYSETCPSSDGACAMILTDRAGAA----RSPRPPAWLHGG 237
300784461 162 GAIVAAKDRRNGALNPYAHLRQPDITVESVRASQMLWDPIRYDETCPSSDGACAMVLGDEAAGD----AVEGGAAWIHAT 237
182440628 162 GSLVAYKDRRNALKNPYAHLHDHDITLEKVRAAPMLWDPIRYSETCPSSDGACAMVLTDREGAA----RSPHPPAWVHGG 237
256392278 241 AMRSEPMGMAGRDSVDPRAGRDCAADVYRQAGVTEPRRQFAAAEVYVPFSWYEPMWLENLGFA-EKGAGWKLTEAGATAF 319
290962781 238 AMRSEPTLFAGKDSVSPRAGRDCAADVYRQAGIADPRREIDAVEMYVPFSWYEPMWLENLGFA-AEGEGWKLTESGVTEL 316
145595169 236 AMRTEPTYFAGKDHVNPRAGVEAAQALWQAAGIADPLAEVDVAEIYVPFSWFEPMWLENLGFA-EAGHGWKLTESGETTI 314
169627936 236 GWRTETGHFAGRDEVNPRAGQECAAAAYREAGITDPGTEVDVSELYIPYSWYEPMWMENIGLA-PESSGWRAVDEGHTAF 314
119716959 237 AMRSEATTAAERDQVNPQASRDAAAALWKQAGITDPIEEIDAAEIYVPFSWFEPMWLESLGFAeANGGGWRLTESGGTAM 316
271963024 235 AMRSEPIFRAGRDTVNPQGGKDCAADVYRQAGITDPRREIDVAEVYVPFSWYEPMWLENLGFA-AEGEGWKLTESGATAL 313
159038414 236 VMRTEPTYFAGKDHVNPRAGAEAAQALWQAAGITDPLDEVDVAELYVPFSWFEPMWLENLGFA-EAGHGWKLTESGETRI 314
29827783  238 AMRSEPTLFAGKDAVSPQAGKDCAADVYRQAGITDPRREIDAVEMYVPFSWYEPMWLENLGFA-DEGEGWKLTESGVTEL 316
300784461 238 AMRTEPTTFAGRDQVNPRAGREAAAALWAEAGITDPMSEVDVAEIYVPFSWFEPMWLENLGFA-PEGEGWKVTEKGETAI 316
182440628 238 AMRSEPTLFAGKDFVSPQAGKDCAADVYRQARITDPRREIDAVEMYVPFSWYEPMWLENLGFA-EQGEGWKLTEAGVTEL 316
256392278 320 DGDIPWNPSGGVLSSNPIGASGMIRFAEAAQQVRGQAGEHQVaaaqDGSRLALGHAYGGGSQFFAMWAVGANKP 393
290962781 317 DGDLPVDMSGGVLSTNPIGASGMIRFAEAALQVRGLAGEHQV----DGARRVLGHAYGGGSQFFSMWLVGAEPP 386
145595169 315 GGRLPVNPSGGVLCSNPIGASGMLRFAEAAMQVMGRAGEHQV----AGARTALGHAYGGGSQFFSMWVVSDTAP 384
169627936 315 GGRHPINPSGGVLSGNPTGATGLLRFAEAALQVRGLAGEHQV----DGARRAIGHAMGGASQFHALWVVGSEKP 384
119716959 317 DGRLPVNCSGGVLSSNPIGASGMLRFGEAALQVRGAAGEHQV----DGARRALGHAYGGGSQFFAMWVVGSEKP 386
271963024 314 DGDIPWNASGGVLSSNPIGASGLIRFAEAALQVRGMAGEHQV----DGARRALGHAYGGGAQFFAMWMVGSDRP 383
159038414 315 GGRLPVNPSGGVLCSNPIGASGMLRFAEAATQVMGRAGERQV----AGARTALGHAYGGGSQFFSMWVVSDTAT 384
29827783  317 DGDLPVNMSGGVLSTNPIGASGMIRFAEAALQVRGQAGEHQV----EGARRVLGHAYGGGSQFFSMWLVGAEPP 386
300784461 317 GGRLPCNPSGGVLSSNPIGASGMLRFSEAAKQVMGRAGDYQV----DGARRALGHAYGGGSQYFSMWLVGSEKP 386
182440628 317 HGDLPVNPSGGVLSTNPIGASGMIRFAEAALQVRGRAGEHQI----DGAARALGHAYGGGAQFFAMWLVGAEPP 386
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap