Conserved Protein Domain Family
PRK08304

?
PRK08304: PRK08304 
stage V sporulation protein AD; Validated
Links
?
Statistics
?
PSSM-Id: 236230
View PSSM: PRK08304
Aligned: 94 rows
Threshold Bit Score: 455.455
Threshold Setting Gi: 295696436
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
238924781  11 QQKLGKWSLRFTEAPFILESSSVVGTKEADGPLGGLFDIVGKDDRFGQNTWEKAESSMQRDALTMALGKAHLDASDMDYV 90 
89895046    3 LKRIGNQTVVFSNPSVILSSYSVVGPMEGQGPLGKTFNKVWQDNINGNTSWEVAETKMLEEAMEGAVKQSQIKKDEIDYL 82 
83590222    4 PKRVGQHTLQFANPPVIVATASVVGPKEGEGPLGDTFDMVIDDSYFGEETWEKAERKMLEEAVKMVIAKAQLKPQDIDFL 83 
78043689    1 ----MRQTREFANPPVVLGYATIAGPKEGEGPLATYFDKIINNLYYYEDTWEKAEQKMFLEVVEMALQKASVKKEEVDFF 76 
134298971   1 ----------------------MAGPKEAEGPLKKTFDKTLEDMYYGEKTWEKAEQKIFQETLELAINKASLTSDKIDYL 58 
114566173   4 KKKRGAQTLVFDQPPVITSWASIAGPKEGQGPWGQDFDWSMEDYLFGEESWEKAENKMLRETVKKALNKRNFDEADTEIL 83 
147677564   4 QKKNGLQTVWFQSPPVIISAASVVGFREGEGPLGKTFDKVVYDSYYGEKTWEKAEQRMMLDAMKKALQKAGLQEKDVDFI 83 
169831382   4 AKKTGQQTLVFRNPPVIVVSGTVVGGKEAQGPLGKTFDLVIDDPYHGEKSWEHAERRMLEDAAKTALKKAGLSQQEIDFF 83 
297616719   5 SKRTGQQSIYFENPPVITNWANIVGPMEGQGPYGQEFDWVLEDYLFGEQSWEKAEAKMLRETVKLVASKANLPLGNIEVL 84 
296133156  11 VKKLGKQTFQLANPPVIVGAAAIVGPKEGQGPLGNIFDLVLPDTLAGEKTWEKAERKMLKDAVNMALQKANLTTKDIDFF 90 
238924781  91 FAGDLLGQSMATTFGVENFRIPWFGVYGACSTCGESLSLAAAFVAAGYARHAVAVTSSHFGSAEKQFRFPNQYANQRPVS 170
89895046   83 LAGDLLNQIISANFAARTMGIPFIGLYGACSTMALSMSVGTMLIDGGFARKVLVGVSSHHDTAERQYRLPTEQGGQRAMS 162
83590222   84 LAGDLLNQTISANYAARSLGIPFLGLYGACSTMYEGMALAAMLIDGGFAHHVVAACSSHYDTAERQYRFPTEQGIQRPPT 163
78043689   77 LAGDLLNQIISANFVAKSLGIPFFGLYNACATFYEGLILGAMLIAGGFAKKVLVGVSSHYATVERQYRNPTEQGVQKTPT 156
134298971  59 LAGDLSNQIIATNFTARNLGIPFLGLYGACSTLYESLILGSMLIDGGYARYVLVGASSHYATAERQFRFPIEQGVQRAMS 138
114566173  84 MAGDLLNQLVSSNYAARELGIPFLGLYGACSTMAESLLLAAILVDGEFFERVIAAACSHHYTAERQFRFPTEQGIQKTPS 163
147677564  84 LAGDLLNQIISANFTASSMSVPFLGLYGACSTMYEGMALGAMLIDGGFADRVLVATSSHYSTAERQYRFPTELGIQRPLT 163
169831382  84 LAGDLENQILASSFAACSLGIPHLGLFGACSTFYEGMVVGAVLIDGGFAEKVLVAVSSHCCTAEKQFRFPTEQGVQRSLA 163
297616719  85 LAGDLLNQIISANFAARELKIPFLGLYGACSTMAEGIALGAMLIDGGFYSTLTVGVTSHHHTAERQFRFPTEQGAQRLPS 164
296133156  91 MAGDLLNQIISANFTARDLGIPFIGLYGACSTMVESLCLGSMLIDGGFANNVAVAASSHYDTAERQYRFPTELGVQRPPS 170
238924781 171 ATWTVTGSAAFIVGsgagGNeiqaVCdnadsisrKVQIEGITTGVVVDYGIKDAMNMGAAMAPAACELIVNHLSDFGRKA 250
89895046  163 AQWTVTGAGSLVLG----QS----GE--------GPRITAATIGRIVDFGETDANNMGAAMAPAVADTVINHFQDMNRTP 226
83590222  164 AQWTVTGAGAVLMA----PV----GN--------GPRITHATIGRVLDVGIKDPNDMGSAMAPAAVDTIVRHFQDTGRGP 227
78043689  157 SQWTVTGAAAVVLG----EG----EG--------KIKIPRVTVGKALDYGMFDPSDMGGAMAPAAFDTLLAHFKETGLSY 220
134298971 139 AQWTVTGAGAIVLA----AQ----GE--------GPRITHATVGRVIDFGEGDASDMGAAMAPAAADTLLRHLSDTGRTT 202
114566173 164 SQWTATAAGAVLLE----PV----GT--------GPRITAVSIGKVIDMDQKDVSDMGSAMAPAAAHTIKTHFSDLNRPS 227
147677564 164 AQWTVTGAGAMLLA----RE----GT--------GPVITHATIGRAIDMGQGDPMDMGAAMAPAAADTIMQHFVDTGRRP 227
169831382 164 QSWTVTGAGAVILA----SQ----GA--------GPVITHATVGKVIDLGQGDPTNFGAAMAPAAADTIVRHFQDTGRPA 227
297616719 165 SQWTVTGCGCLIIQ----RD----GV--------GPRITTATVGKVIDLGQSDVNDMGAAMAPAAADTIVAHFRDTGRDP 228
296133156 171 AQWTVTGAGAMVVS----GT----GI--------GPAVTHVTIGKVIDLGIKDANDMGSAMAPAAADTIVAHFKETTRQP 234
238924781 251 SYYDRIVTGDLGSVGQKILIDLCRQKGVDISKNHEDCGMKMFDATNQNTGSGGSGCACSATVLSAYYLPKLRSGELKRIL 330
89895046  227 EDYDLIISGDLGSVGLNLTQEVLKKSGLHF-QNFSDCGVLIYD-KSQDAHAGASGCGCSAVVFAGHIMEKIKSGQYKRVL 304
83590222  228 IDYDLIITGDLGRVGHEIATKLLGEKKYDVSKNYSDCGILIYDHERQDTHAGGSGCACSAVVFAGHLMGKLNEGRYKRIL 307
78043689  221 DYYDLMATGDLARFGWQILVKLLQERNINFGQRLTDCGIMIYR-PDQQVNAGGSGTACSALVTAGYVFNELSQGKIHKFL 299
134298971 203 ADYSLIASGDLGKYGRELVVRLAEEQAVKLSDTYVDCGVLVFD-ESQDTHAGGSGCACSAVVTCGYILNGMKEGWIKTFL 281
114566173 228 DYYDLIVTGDLGKVGMAITQELFIKDGLQPEPNYSDCGVLLYD-DFQEVYAGGSGCGCSACFLCGPLLKKMSAGEINKLL 306
147677564 228 DYYDLIITGDLGAYGKKLAEQILAKNGYDIADRFTDCGILIYS-GSQDVHAGGSGCGCSAVVTCGYLMEQLKSGRYKRFM 306
169831382 228 DYYDLVVTGDLGIYGRELAQGLIGDHGYQVEGRFTDCGILIYDHDKQDTHAGGSGCACSAVVTGGYLLQQIQTGKLQRLL 307
297616719 229 RYYDLIITGDLGKYGLALMESLCQKLNCPLGQHVSDCGVLIYD-IDQDVHAGGSGCGCSAVMLCGPLLNRMQAKEFNRIL 307
296133156 235 SDYDLIISGDLASIGHSLTIQLVKQAGYDMSKNFTDCGILIFD-PSQDTHAGGSGCGCSAVVLSSYILGQMKAGKYKRVL 313
238924781 331 FVPTGALLSPVSFNEGESVPGIAHGVVLEAVI 362
89895046  305 LVGSGALHSPTSSLQGESIPGIGHAVVIEA-- 334
83590222  308 GVGTGALLSTTATQQGESIPGIGHGVVIEG-- 337
78043689  300 GIGTGALLSQVTSQQGMSIPVIAHAVSFECY- 330
134298971 282 GIGTGALLSPCSCQQGETIPGIAHAVALEN-- 311
114566173 307 FVATGALMSPITSFQGESIPAIAHAVAIEN-- 336
147677564 307 GVGTGALMSPCSVQQGETIPGIGHAVVIEAR- 337
169831382 308 GVGTGALLNADSPKQGETIPGIGHAVVIERR- 338
297616719 308 LVGTGALMSTTSSLQGETIPCIAHAVAIEN-- 337
296133156 314 AIGTGALLSPTATLQGESIPGVAHAVVMDAHS 345
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap