Conserved Protein Domain Family
PRK08257

?
PRK08257: PRK08257 
acetyl-CoA acetyltransferase; Validated
Statistics
?
PSSM-Id: 236204
View PSSM: PRK08257
Aligned: 61 rows
Threshold Bit Score: 521.011
Threshold Setting Gi: 262203244
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
197105037   1 MGDRTPVLIGAGQFTYRGDPATSP--SPTALLKIAAERAALDAGLGaaGLSAIDALAVVGFTIDapgskrgmipHSNNPP 78 
39934825    6 PPERIPVIAGVGEIADHPKDIAQGl-EPLALLEAAVQRAGDDSAVS--LLPQIDSLDVVNFLSW----------RYHAPA 72 
115523719   5 AADHIPVIIGVGEIADRPKDLAAGl-EPLALMHEALKRAEADSGAR--LLHQIDSLDVVNLLSW----------RYHDPD 71 
91976335    6 SPDRIPVIAGIGEIADHPKDLAQGl-EPLALLEQAVRRAGADASPT--FIEEIDSLDVVNFLSW----------RYRDPE 72 
86750717    6 PPERIPVIAGIGEIADHPKDIAQGl-EPLALLEQAARRAGDDSSVH--LLREIDSLDIVNFLSW----------RYHAPE 72 
192290349   6 PPERIPVIAGVGEIADHPKDIAQGl-EPLALLEAAVQRAGDDSAAS--LLPQIDSLDVVNFLSW----------RYHAPA 72 
226307835   4 DASRIPVIVGVGDLRWNPADRHR---EPLDLIHDATVAALNDSGHAe-LGTQIDSVFAIKTVSW----------SYNDLP 69 
85372884   13 NPEHVPVIIGVGQINDRPADPREGl-DPVGLMAEALRRADADGGGG--WLEDCQSLGIVGQIAWp---------QINPVA 80 
103487293   3 DPERIPVIIGVGQVNDRPADPDDGl-DSLGLMVAALKVAADDAGV---SLTDIDSLAIVDQISFh---------HLGKLC 69 
111022651   2 DPTRIPVIVGVGDIRSGRAGDPAAprEPLDLITDAARAALADSGSAt-LGSRIDAIHAVKTVSW----------SYDDLP 70 
197105037  79 ANLAGKIGAAPRWSVYSE-MGGNTPQYLINTLAERIARGETDLALAVGCEFLGSAMKRATR--GlSFDDWKADEPEdlpp 155
39934825   73 EQLATRLGIAPRHCFYGP-VGGESPIRFIHEAALRIARGEAKVAVVCGAEAQSTATKAARA--K-LDLPWTPFAHDa--- 145
115523719  72 QQLAAKLGIAPKHSHYGP-VGGESPIRFLHEAAQRIARGESRVAAVTGAEAQSTATKAQRQ--N-LTLPWTPFAHDv--- 144
91976335   73 KLLAARLGVTPRHCQYGP-VGGESPIRFIHEAALRIARGEVSVAIVCGAEAQSTATKAARA--K-LELPWTPFATDv--- 145
86750717   73 QQLAAKLGVSPRHCYYGP-VGGESPIRFIHEAALRIARGEAHVAVVCGAEAQSTVTKAARA--K-LELPWTPFASDa--- 145
192290349  73 EQLATRLGIAPRHCFYGP-VGGESPIRFIHEAALRIARGEAQVAVVCGAEAQSTATKAARA--K-IDLPWTPFAHDa--- 145
226307835  70 GLLASRLGATPTVTSTSP-IGGHWPAALLDRIGAAIARGESSAALLVGGESHASSTALRKSgvApDSIGWTAAPGGp--- 145
85372884   81 GKVAEALGIDPAHVEETT-PHGDNPIRLLNEAANRIGAGEAVICAVTGGEALRTAGALAKMkaA-EEAANSPEKAKpkeh 158
103487293  70 EPLAAAIGANPAIKYQSAaPHGDTPVRLLNEAANRIGAGEVKLAAVVGGEALRTAAGRAAKaaSgEDKSYNAVRRV---- 145
111022651  71 GLLAARLNLPSPRSSTSP-IGGHWPAAFLDRIGDDIAAGRSSAALLVGGEAQATMTALRKSgtDpASLGWASAPGGp--- 146
197105037 156 pqRIGDPRPGNTAYEARHGIDRPINIYPLFENALRARDGRSIPDHQRRMGKLFAGFSKVAAGNPEAWFPIERSAEELVTV 235
39934825  146 -pEPKRGAAFQQPIASTLGVARPITVYPLYEAATAAHWGQTPRQALDESGVLWSRYAAAAERNPNAWIKRAFAPNEITTP 224
115523719 145 -pEPKRGAAFQKPMATALGVMRPITVYPFYENATAAHWGQTPRQAIAESGALWSRFAQAAMRNPSAWIKRDFTPDAITMP 223
91976335  146 -pEPKRGAAFQKPIAGQLGVARPITVYPLYEAATAAHWGQTPRQALAESGVLWSRYAESASSNPNAWSKRAFEPGEITTP 224
86750717  146 -pEPKRGAAFQKPIATQLGVARPITVYPLYEAATAAHWGQTPRQALDESGVLWSRYAQAAAANPNAWIKRAFAPSEITTP 224
192290349 146 -pEPKRGAAFQQPIASTLGVARPITVYPLYEAATAAHWGQTPRQALDESGVLWSRYAAAAERNPNAWIKRAFAPNEITTP 224
226307835 146 --PGFDPTDLGSPEMQRAGFIVPTRVYPLFENCFSAAEGHDARESLDWSARMYAAFSELASKNPASWTSEIRSADEIGTV 223
85372884  159 daLRDASHRRKLGYAQSYGLVVPVDVYPLYENAFRAAQGQTLTEGQAESGAIWAGFSQVAARTEAAWIREPRQAEEIIEP 238
103487293 146 ------ATRREPNYAQKHGLAAPVDVYPLYENATRAAWGQSLADAQLESAEIWSRFSEVAAGNEGAWIRKPASPDDILDV 219
111022651 147 --PAFDPADLGSPAMQRAGLIVPTRVYPLFENRVAHESGVGPDQSLAESARMYSAFSELAAKNPASWTSEVYSVQEIATV 224
197105037 236 TEKNRMIGFPYPKLLNAIMEVDQSAAVLIASEAKARELGVPESNFVYLHGCADAADLWHPLDRQDFHSSPAMRRTGQkaf 315
39934825  225 SSDNRLIAWPYTKLMVANPSVNLGAAVLLTSLAKARAAGIPEDKLIYIHGGASAEEPRDYLARDQFVQSHAQNAVLEtik 304
115523719 224 SPDNRLIAWPYTKLQVANPMVNQGAALLITSLAVAREAGIAEHRLVHFCGGASAEEPRDYLIRDQFFESHAQNAVLRaal 303
91976335  225 SPDNRLIAWPYTKLMVANPSVNLGAAVLLTSLAKAREAGIAEDRLIYIHGGASAEEPRDFLSRDQFHQSHAQNAVLEtik 304
86750717  225 SPDNRLIAWPYTKLMVANPSVNLGAAVLLTSLAKAREAGIAEEKLIYIHGGASAEEPRDYLARDQFHQSHAQNAVLEtik 304
192290349 225 SSDNRLIAWPYTKLMVANPSVNLGAAVLLTSLAKARAAGIPEDKLIYIHGGASAEEPRDYLARDQFVQSHAQNAVLEtik 304
226307835 224 GPGNRMVSEPYPLMLNAMPFVNQAAAVVVCSLSTAREFGIDESKLVYLWGGAGASDPLDILSRNSFDSSAAMHDAVHral 303
85372884  239 TADNRPIAFPYTKLQVANSAVNQGAGFIVTSLAEARRRGVSEDRLVFVGAGASAFEPDSILARDSYTASAGMETSIRkam 318
103487293 220 NERNRPIAFPYSKLMVANSSVNQGAGFLVASLAEARRRGIAEDRLIYIGMGAAAKEPASILARDRYDHSVSMETSIArtl 299
111022651 225 GPGNRMVCEPYPLMLNAMPFVDQAAAVLVCSLAVARDHGVPEERTVYLWGGAGAADPVDVLSRNGFGTSAAMTNAVHral 304
197105037 316 EMAGIGLSDIDLIDLYSCFPVAVEIGAEELGLSLDdpRGLTVTGGLPYAGGPGNNYVMHSVAAMLGKLRerPGAYGLITG 395
39934825  305 AMVGGDGRAFDAIELYSCFPVVPKMARRTLGLGDD--VEPTVTGGLTFFGAPLNTYMTHAACAMARRLRd-GAKVGLLYG 381
115523719 304 DLAGGDARAFDAIELYSCFPVVPKMARRTLGLGDE--FQPTVTGGLTFFGAPLNTYMTHAACAMVRSLRd-GATLGLLYG 380
91976335  305 TMVGGDGRAFDAIELYSCFPVVPKMARRTLGLGDD--VQPTVTGGLTFFGAPLNTYMTHAACAMVRKLRd-GAKLGLLYG 381
86750717  305 AMVGGDGRVFDAIELYSCFPVVPKMARRTLGLGDD--VQPTVTGGLTFFGAPLNTYMTHAACAMVRRLRg-GARLGLLYG 381
192290349 305 AMVGGDGRAFDAIELYSCFPVVPKMARRTLGLGDD--VEPTVTGGLTFFGAPLNTYMTHAACAMVRRLRd-GAQLGLLYG 381
226307835 304 DGAGVGADALDIVDAYSCFPIVPKLLIRELGLPDT--AIPSVTGGHSFFGGPLNSYTLHSVAEVTRRIRd-GANLALVHG 380
85372884  319 ELNAVPADDLDHVELYSCFPCVPKMARRTLGWPLE--KPMTVFGGLTFGGGPIGNYMSHAVACMVEKLR--GGGTGLLFA 394
103487293 300 ALNGMTAHDFDCVELYSCFPCVPKMARRILGWPLD--RPASVFGGLTFGGGPIANYMSHAVVSMVEKLRs-EGRYGFLFA 376
111022651 305 SRASIDASALDIVDAYSCFPVVPKLLTRTLGLPES--IVPSVTGGHSFFGGPLNSYTLHSIAEVTRRLRegAGP-ALVHG 381
197105037 396 NGWYLTKQSTGIYSTKRp-EAPFEREDPAILQREIDAL--PHPEIVERPSGRGTIETYTVVHRREGPFT-AIVVGRDEAG 471
39934825  382 QGGFVTKHHGLIVSGTP---PQQPLSEDVSVQAKADAAygVVPRFVTEASGDGTVETFTVIYDGRGEVQhGVVMLRTVDG 458
115523719 381 QGGFVTKHHALVLSRAA---PEAGLAQDHNVQSIADAArgAVPPFVTEAGGDGVVESFTVIYGRDGEVEhGVVMLRTEDD 457
91976335  382 QGGFVTKHHALVVSRTP---PQGALSDDVSVQAKADAAygPVPPFITEASGNGSVETFTVIYSGRGEIEhGVVVLRTTDG 458
86750717  382 QGGFVTKHHALVLSRTP---SQQALSESVSVQTKADAAygDVPPFVTDASGDGTVESFTVIFTGKGDVEhGVVVLRTSDG 458
192290349 382 QGGFVTKHHGLIVSRTP---PQQPLSEDVSVQAKADAAygVVPRFVTEASGDGTVETFTVVYDGRGEVQhGVVMLRTVDG 458
226307835 381 NGGFLTYQHCVLLSSTA-------HADGYVGDPDARALtaEAPELITDYTGTAEIVTASVEYGRTGEPEiGFVIAATPDG 453
85372884  395 NGGYATHSHTIVLSAQP--IEGVGFPQDFDYNDAAEKArdDVPPLDKTYSGPATIETYTVHYKRDGSPRvGTVVARTPDG 472
103487293 377 NGGFATDNHCIVLGNQP--IAAASFPQDFDYQAEAEAKrgPVPELAEDYAGPATIESYTVFYGRDGEPKaGVVVARTPDG 454
111022651 382 NGGYLTYQHVVLLAGAPhpGGYVGDPEPVQLAS-------EAPELVTSYEGRADIVTSTVEHGRDGAPAtGFVVAHTPDG 454
197105037 472 RRFAANTp-QDPQLLAAM---EVSEQVGRSGTVGP--APDGQTNLFT 512
39934825  459 ARALARVpaQDQATLAFLt-dMDRSAVGTRGPIVT--AADGVLEWRS 502
115523719 458 ARTLARVraDDAATLARLt-dLNRSPVGAHGAIST--AADGILEWRI 501
91976335  459 ARALARVpaQDQATLAFLt-dMDRSPVGTHGTIST--AADGVLEWRA 502
86750717  459 ARTLARVpaQDQATLAVLt-nMDRSPVGTNGPITT--SADGVLEWRA 502
192290349 459 ARALARVpaQDQATLAFLt-dMDRSPVGTRGPIVT--AADGVLEWRS 502
226307835 454 RRVAGHTgpENAAELTQLr-gDNPAAIGRTVHIS---DENGKLTLTF 496
85372884  473 ARTLAVVppEDAATIALLt-dGKVEPVGQKGRIVR--AGHGEWDGMG 516
103487293 455 QRTLAHVdvSDAAMLAFLt-dGTREPVGTEGQVVQlvEGYGWRTA-- 498
111022651 455 RRLAGHTgsEEALALSAFaqtPARSVIGRSVDVT---DRDGILSLRF 498
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap