Conserved Protein Domain Family
PRK08256

?
PRK08256: PRK08256 
lipid-transfer protein; Provisional
Statistics
?
PSSM-Id: 181327
View PSSM: PRK08256
Aligned: 72 rows
Threshold Bit Score: 641.563
Threshold Setting Gi: 163840874
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
182438997   1 MKAYIVGVGMTRFEKPEtRDWQYWDMVREAGTAALADAGVRYDQVEQVPVGYCFQASTAGQRAVYELGLTGVPVYNVNNN 80 
288960846   3 AKAVVAGVGMIPFVKPG-TSDTYDLMGARAVRFALEDAGITYGDVGQAYAGYVYGDSSCGQRALYHVGLTGIPLVNVNNN 81 
226308406   3 RKAFVAGVGMIPFTKPG-KSDDYDVMGAGAATAALEDAGLEYSKVQQAYVGYVYGDSTSGQRALYNLGETGIPVINVNNN 81 
304311348   3 RRANVIGVGMTKFSKPG-SSPEYYEMARDAGLNALKDAGIPYSAVQQAYVGYVYGDSTCGQRAVYELGLTGIPVVNVNNN 81 
239820438   6 RPVHVVGVGMIPFTKPG-ASDPYTVMGARAARLALDDAGVDYSLVQQAYVGYVYGDSTAGQAAIYGVGLSGIPVFNLNNN 84 
226361783   5 TDVHVAGVGMIPFTKPG-RSASYSDMGEAAARAALADAGLDYAAVQQAFVGYVYGDSTSGQAALYGLGQTGIPIVNVNNN 83 
94314745    3 NKVVVAGVGMIPFTKPG-ASDDYGVMGARAAKAALADAGIDYALVQQAYVGYVFGDSTSGQTAIYGVGLTGIPVINVNNN 81 
158520949   2 RKVNVIGVGMTPFSTPK-AKIPYTDMAKQAAGDALKDAGVGYNDIQHAYTGWVYADSCAGQMALYDIGMTGIPVFNVNNN 80 
73538582    3 NKVVVAGVGMIPFTKPG-ASDDYGVMGANAAKAALADAGIDYALVEQAYVGYVFGDSTSGQAAIYGVGLTGIPVINVNNN 81 
154250611   3 NRVVVAGVGMLPFVKPG-ASAPYDDMGAEAARLALKDAGIGYDKVEQAYVGWVYGDSTSGQAALYKVGLTGIPVVNVNNN 81 
182438997  81 CATGSTALMLARQFVEGGGSDCVLAVGFEKMSRGSLGAGAGGagdfATSPVARHYGIMAAAHGFeA--SPPTAQIFGNAA 158
288960846  82 CASGSSALFLARQAVEAGAVDCALAFGFEQMMPGALPTVFAD----RPDPLADWKSLSQDLQPA-DpaTPPAAHLFGGAG 156
226308406  82 CATGSTALWLARQAVESGAVECALALGFEQMQPGALKGAWTD----RPRPLGRFDEVLEAAAGI-DasVPRAAQYFGVAG 156
304311348  82 CSTGSSALYLARQAIEGGLAECVLALGFEKMEKGALGAKFND----REPPMGKHAQVMIEAQGF-Tq-APPAAQMFGGAG 155
239820438  85 CSTGSSALFLARQAVESGMVECAIALGFEQMQPGALKGAYDD----RPSPMARFAETMAEKQGY-VpeAPRAAQFFGGAG 159
226361783  84 CSTGSTALWLARQAVASGTVDCALALGFEQMVPGALGSVFSD----RPGPMARQEAARDELQGV-DpqAPMAAQFFGGAG 158
94314745   82 CATGSTALYLARQAVESGAVECAIALGFEQMVPGALKGAYTD----RPGPMERFARVMNDVQGF-DeqAPRAAQFFGGAG 156
158520949  81 CSTGSNALFLARQAVATGVVECAMALGFEQMTPGALGVVFND----RPIPMQTFFIKLFEFQEP-KpgAPPAAMLFGGAG 155
73538582   82 CATGSTALFLARQAVESGAIECAIAVGFEQMVPGALKGAYTD----RPGPMERFAKTMAQVQGF-DeqAPRAAQFFGGAG 156
154250611  82 CSTGSSALFLARQAVEAGVVDCAIALGFEQMTPGALGTMYDD----RPNPLGDFLKVADDSFQG-AseVPMALRLFGGAG 156
182438997 159 REHMERYGTTPEQLAAVGAKNHRHSVHNPYAQFQDPYTVEEILAARTVHRPLTKLQCSPTSDGAAAAVVVSERFVERHGL 238
288960846 157 VEHAAKYGTRPETFARISEKARRHAEHNDRAIFRTPLTVEQILASPTIYGILTRYQCCPPTCGAAAALIVSEDFARKRGI 236
226308406 157 MEYMEKFGMKAETFAKIQVKARKHSADNPYAVFRTQLTEEEVLAAPTLFGPVTRYQACPPTCGAAAAIICTEEFARANGL 236
304311348 156 REYRWHHGTKRETFGQIAVKARKHASNNPYALFGQVLSLEEILASDEVFDPLTRFQCCPPTCGAGAAIICSDEFARKHGI 235
239820438 160 RDYMAQHGIRRDTFGRISVKARQHAARNPLAVFRQTLTLDEVMASPLVFDPLTRFQCCPPTCGAAAAIVCSAEFAEKHGL 239
226361783 159 QAYVDEFGIDPAIFAEISVKARKHAANNPNAVFRALVTAEEVLASPKIYGPLTRLQCCPPTCGAAAAVVCSPEFARKHGL 238
94314745  157 RAYMKEFGIRPETFARISVKARQHAARNPFAVFRNTVTLEDVMTSPKVFDPLTRLQCCPPTCGAAAAILCTEAFARKHGL 236
158520949 156 VEYQQKYGISDEVFGKISVKARKHAQHNERAVFRDLLSLDEVMSSPHIFGPLTRYQCCPPTCGAAAAILCSDEFAKKHNI 235
73538582  157 RAYMKEYGIRPDTFARISVKARQHAARNPFAVFRNTVTLEEVMAAPTVFDPLTRLQCCPPTCGAAAAILCTEAFARKHGL 236
154250611 157 YEYQQAFGAKTETFAKVREKASRHAEHNERAIFRTPVSVDDVMQSPKMFLNLTRLQCCPPSCGAAAAVLCSEAFARKHGL 236
182438997 239 gERAVEIAAQAMTTDTETSFASGSCIDAVGAPMTRAAAQQVYTASGLGPDDLDVIELHDCFSVNELLTYEALGLCGEGES 318
288960846 237 -DASIRILGQELMTDLPSSFGERSMIKAVGFDLSKTAAARVYEMAGIGPDEVDVCELHDCFTANELVTYEALGFAPEGGA 315
226308406 237 -RTDVAIKAQSMTSDLPSTFDEGSMIKAVGYDVTASAARHVYEASGVDPRDIEVVELHDCFTVNEVLCYEALGLVEEGGA 315
304311348 236 -SNPVYIAAQAMTTDFASSFDEQSMIKMVGYDMTKDAARQVYEQAGIGPEDIQVVELHDCFTANELLTYEALGLCPEGGA 314
239820438 240 -DMRVVIAAQAMTTDTPSTFESKDMRKLVGYDMTAAAARQVYEDAGIGPEELDVVELHDCFTANELITYEALGLTPEGTA 318
226361783 239 -AADVVIRAQSLTTDTPSTFESKDMRQVIGYDMAAAAARNVYEAAGIGPEDIRVVELHDCFTTNEFLTYESLGLTPAGTA 317
94314745  237 -DTRVAIAAQAMTTDRNSTFDEGDMRKVVGYDMTHAAATQVYERAGIGPGDVDVVELHDCFTANELITYEGLGLTPEGTA 315
158520949 236 -SNPVYIAGQSMNTDFTSTFEARSAMNICGYEMSKAAANDVYEQAGLGPEDLDVVELHDCFTANELITYEALGLTPEGTA 314
73538582  237 -DTRVNIAAQAMTTDRNSTFDEGDMRKVVGYDMTAAAAKAVYEKAGVAPTDIDVVELHDCFTANELITYEGLGLTPVGTA 315
154250611 237 -DASIVIAGQAMTTDYPSTFAEKSLIKVVGSDMTKEAARRVYEQAGIGPDDVDVVELHDCFTTNEVITYEGLGLCPEGGA 315
182438997 319 GELVESGATTYGGRWVVNPSGGLISKGHPLGATGIAQAAELTWHLRDEAGARQVPGARTALAHNIGLGGAAVLTLLRRG 397
288960846 316 EKFILDGDNTYGGKVVTNPSGGLLSKGHPLGATGLAQCFELVEQLRGKCGPRQVENARFALQHNIGTGSACAVTLYGKV 394
226308406 316 EQFILSGDNTYGGRVVVNPSGGLLSKGHPLGATGLAQCAELVWQLRGDAGPRQVDGATLALQHNLGLGGAGVVTLYEKV 394
304311348 315 EKFIWDGDNTYGGKFVTNPSGGLLSKGHPLGATGLAQCTELVWQLRGTADKRQVDNARIALQHNLGLGGACVITMYRRD 393
239820438 319 ERFIVEGDNTYGGRVVTNPSGGLLSKGHPLGATGLAQCAELVWQLRGRAEQRQVEGARLALQHNLGLGGACVVTLYQSR 397
226361783 318 EKFIRDGDNTYGGRVVTNPSGGLLSKGHPLGATGLAQCAELVWQLRGQAGARQVEGVNLALQHNLGLGGACVVTLYQKV 396
94314745  316 EKFILDGDNTYGGRVVTNPSGGLLSKGHPLGATGLAQCAELVWQLRGEAGDRQVAGARLALQHNLGLGGACVVTLYQRQ 394
158520949 315 EKFIEDGDNTYGGKYVTNPSGGLLSKGHPLGATGLAQCAELTWQLRGQSGVRQVEGAKVALQHNIGLGGCCVVGMYRRD 393
73538582  316 EKFIVDGDNTYGGRVVTNPSGGLLSKGHPLGATGLAQCAELVWQLRGKAGDRQVEGARLALQHNLGLGGACVVTLYERQ 394
154250611 316 EKFVWDGDNTYGGKVVTNPSGGLLSKGHPLGATGLGQCAELTWQLRGQSGKRQVEGARVALQHNLGLGGACVVTLYERV 394
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap