Conserved Protein Domain Family
PRK08242

?
PRK08242: PRK08242 
acetyl-CoA acetyltransferase; Validated
Statistics
?
PSSM-Id: 236197
View PSSM: PRK08242
Aligned: 141 rows
Threshold Bit Score: 654.645
Threshold Setting Gi: 189912777
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
45656862    1 MSNAYVIDAVRTPRGKGKKrGALASIHPQELSAATLNAIQERNGIKPEIVEEVVMGCVSQVDDQAACIARYAVMSALWPN 80 
24215834    1 MSNAYVIDAVRTPRGKGKKrGALASIHPQELSAATLNAIQERNGIKPEIVEEVVMGCVSQVDDQAACIARYAVMSALWPN 80 
189912777   1 MGNSYIIDAVRTPRGKGKKrGTLASVHPQELAAATLKAIQSRTGIDPKTVEEVVMGCVSQVADQAACIARYAVMAAHWPK 80 
116329089   1 MSNAYVIDAVRTPRGKGKKrGALASIHPQELSAATLNAIQERNGIKPEIVEEVVMGCVSQVDDQAACIARYAVMSALWPN 80 
146278330   1 MTEAYIYDALRTPRGKGRPdGALHEVTALTLSARVLNAVKERNNLDGAAVEDVIWGNATQVGEQGGCLARSAVLLSDLDE 80 
56697756    1 MTEAYIYDAVRTPRGKGRKdGSLHEVTSVRLSALTLNALKERNNLEGHAVEDVIWGNVTQVMEQGGCLARTAVLASDLDQ 80 
159043388   1 MTEAYIYDAIRSPRGKGRKdGSLHEVTAVSLSAQTLNAIKDRNGLTGHAVEDVIWGNVTQVMEQGGCLARTAVLASDLDE 80 
89055466    1 MTDAFIYDAIRTPRGKGRRdGALHEVTSARLSAFTLNTLKERNGLEGHAVEDVIWGNVTQVMEQGGCLARAAVLASDLDE 80 
99081402    1 MTEAYIYDAVRTPRGKGRKdGALHEVTSVRLSALTLNALKERNNLEGHAVEDVIWGNVTQVMEQGGCLARSAVLASDLDQ 80 
110681105   1 MTDAYIYDALRTPRGKGRKdGSLHEVTSLRLSALTLNALKDRNNLEGHAVEDVIWGNVTQVMEQGGCLARSAVLASDLDE 80 
45656862   81 SVPGYTVNRFCGSGLQAVNNAANHVQSGSMQIALGGGVESMSRVKMGADmnGRDFNIgNPNIQKHYNLVPQGISADLIAT 160
24215834   81 SVPGYTVNRFCGSGLQAVNNAANHVQSGSMQIALGGGVESMSRVKMGADmnGRDFNIgNPNIQKHYNLVPQGISADLIAT 160
189912777  81 DVPGYTVNRFCGSGLQALNNVANHVASGAMELGVGGGVESMSRVKMGDDmiGRDFNVgNDKIAAHYNLVPQGISADLIAT 160
116329089  81 SVPGYTVNRFCGSGLQAVNNAANHVQSGSMQIALGGGVESMSRVKMGADmnGRDFNIgNPNIQKHYNLVPQGISADLIAT 160
146278330  81 TIPGLSINRFCASGMEAVNLAANQVRAGAGEAYIAGGVEMMSRVAMGSD--GAAIAV-DPSLAMKSYFVPQGISADIIAT 157
56697756   81 SIPGLAINRFCASGMEAVNLAANQVRGGAGDAYIAGGVEMMGRVAMGSD--GAAIAV-DPSIAMETYFVPQGISADIIAT 157
159043388  81 SIPGLAINRFCASGLEAVNLAANQVRGGGGQAYIAGGVEMMGRVPMGSD--GAAIAA-DPSVAMKTYFVPQGISADIIAT 157
89055466   81 SIPGLAINRFCASGLEAVNLAANQIKGGAGDGYIAGGVEMMGRVAMGSD--GAAMAV-DPQLAMGSYFVPQGISADIIAT 157
99081402   81 SIPGLAINRFCASGMEAVNLAANQVKGGAGDGYIAGGVEMMGRVAMGSD--GAAIAV-DPSLAMDTYFVPQGISADIIAT 157
110681105  81 RIPGLAINRFCASGMEAVNLAANQVRGGAGQAYIAGGVEMMGRVAMGSD--GAAIAV-DPTLAMEKHFVPQGISADIIAT 157
45656862  161 KFGISREEADRFAESSQIKADKAIKEGYFKKSIIPVKTEDG-TIVDSDENPRIESTFEWLSDLAPVFKTIGE--KELDAI 237
24215834  161 KFGISREEADRFAESSQIKADKAIKEGYFKKSIIPVKTEDG-TIVDSDENPRIESTFEWLSDLAPVFKTIGE--KELDAI 237
189912777 161 KYDISREEADRFAESSQQKAHAAIQNGYFKKSVIPITLDDG-TVVTEEENPRLESDYAFLSSLGPVFKTIGE--KELDAI 237
116329089 161 KFGISREEADRFAESSQIKADKAIKEGYFKKSIVPVKIEDG-TIVDTDENPRIESTFEWLSDLAPVFKTIGE--KELDAI 237
146278330 158 RFGFSRDEADALAVESQRRAAAAWAEGRFARSVVPVRDQNGvTILDRDEHMRPGTDMQSLGSLRPAFKEMGEqmPGFDKL 237
56697756  158 EYGFTRDQADALAMESQRRAKEAWDEGRFAKSVIPVRDQNGlTILDHDEYMRPGTDMQSLGGLNPAFQMMGEqmPGFDKI 237
159043388 158 EYGISRDDADALAVASQRRAKAAWDENRFNGSVFTVRDQNGlNILDHDEYMRPETDMQSLGALKPAFKDMGEqmPGFDKI 237
89055466  158 EYGFTRDEVDAYSVESQNRAAAAWADHRFGKSVITVKDQNGlTILDKDEYMRPQTDMQSLGALKPAFKDMGEamPGFDAV 237
99081402  158 EYGFTRDQADALAVESQRRAKAAWDDNRFAKSIITVRDQNGlAILDHDEYMRPGTDMQALGSLNASFQMMGEvmPGFDAV 237
110681105 158 EYGFSRDDADTLAVESQRRAKQAWDEGRFDKSVIEVRDQNGlKILDHDEYMRPQTDMQSLGALNPAFQAMGEvmPGFDKV 237
45656862  238 ALKSYPEIPKINHIHTLGNSSGIVDGAASVLLASDEGIKKYGLKPRARIAAMASTGEDPTIMLTGPVSASKKALAMAGLK 317
24215834  238 ALKSYPEIPKINHIHTLGNSSGIVDGAASVLLASDEGIKKYGLKPRARIAAMASTGEDPTIMLTGPVSASKKALAMAGLK 317
189912777 238 ALRSYPEVKKINHIHTLGNSSGIVDGAAAILVTNDDGLKKYGLKPRAKILATVATGEDPTIMLTGPVSASQKALKQAGLS 317
116329089 238 ALKSYPEIPKINHIHTLGNSSGIVDGAASVLLASDEGIKKYGLKPRAKIVAMASTGEDPTIMLTGPVSASKKALAIAGLK 317
146278330 238 AMMKYPELERVDHIHHAGNSSGIVDGAAAVLIGSRAFGEAHGLKPRARIRAAAKIGTDPTIMLTGPVPVTEKILRDSGMQ 317
56697756  238 AMLKYPHLERINHIHHAGNSSGIVDGAAGVLIGNKEFGEKYGLKPRARIKATAKIGTDPTIMLTGPVPVTEKILADNGMK 317
159043388 238 ALMKYPHLEKIEHIHHAGNSSGIVDGSAALLIGNKAFGEAHGLKPRAVIKATAKIGTDPTIMLTGPVPATEKILADSGMS 317
89055466  238 ALMKYPHLEAINHIHHAGNSSGIVDGSAAILVGNKEFGEKWGLTPRAKIRANAKIGTDPTINLTGPVPVTEKILSENGMS 317
99081402  238 AKLKYPHLEKVNHIHHAGNSSGIVDGSAALLIGNKEFGERHGLKPRARIKATAKIGTDPTIMLTGPVPVTEKILKDTGMT 317
110681105 238 ALMKYPHLERINHIHHAGNSSGIVDGAAAVLIGNKEFGEEHGLKPRARIRATAKIGTDPTIMLTGPVPVTEKILADSGMD 317
45656862  318 PEDIDLWEINEAFASVVLYTQKSLGIPIEKINVNGGSISLGHPLGATGAILLGTALDELERRQKRYALITLCIGGGMGIA 397
24215834  318 PEDIDLWEINEAFASVVLYTQKSLGIPIEKINVNGGSISLGHPLGATGAILLGTALDELERRQKRYALITLCIGGGMGIA 397
189912777 318 VKDIDLWEINEAFASVVLYVKKTLGIDESKINVNGGAIALGHPLGATGAILTGTVLDELERRDLRYGLITLCIGGGMGIA 397
116329089 318 ADDIDLWEINEAFASVVLYTQKSLNIPLEKINVNGGSISLGHPLGATGAILLGTALDELERRQKRYALITLCIGGGMGIA 397
146278330 318 ISDIDLFEVNEAFAAVVLRFQQAFDVDPDRVNVNGGAIAMGHPLGATGAIIIGTLLDELERTGKGVGLATLCVASGMGAA 397
56697756  318 IGDLDLFEVNEAFASVVLRFQQAFDVDPALVNVNGGSIAMGHPLGATGAIIIGTLLDELERRDLETGLATLCIASGMGAA 397
159043388 318 ISDIDLFEVNEAFSSVVLRFMQAFDVDHDKVNVNGGAIAMGHPLGATGAMILGTLLDELERTGKGTGLATLCVASGMGAA 397
89055466  318 IDDIGLFEVNEAFAAVVLRFLQAFDVDHAKVNVNGGAIAMGHPLGATGAMILGTLLDEMERADKETGLATLCVAAGMGSA 397
99081402  318 ISDLDLFEVNEAFASVVLRFQQAFDVDPALVNVNGGSIAMGHPLGATGAIIIGTLLDELERQDKECGLATLCIASGMGAA 397
110681105 318 IKDIDLFEVNEAFAAVVLRFLQAFDVDDAKVNVNGGSIAMGHPLGATGAIIIGTLLDELERDDKEVGLATLCIASGMGAA 397
45656862  398 TIIERI 403
24215834  398 TIIERI 403
189912777 398 TIIERL 403
116329089 398 TIIERM 403
146278330 398 TIIERV 403
56697756  398 TIIERV 403
159043388 398 TIIERV 403
89055466  398 TILERV 403
99081402  398 TIIERV 403
110681105 398 TIIERV 403
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap