Conserved Protein Domain Family
PRK08234

?
PRK08234: PRK08234 (this model, PSSM-Id:103275 is obsolete)
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 103275
View PSSM: PRK08234
Aligned: 4 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15612768    1 MEEVVIIDAVRTPIGRYNGALRDVRPDDLGAIVLRALKERNPQVPIDEVEEVVFGNANGAGEDNRNVARMSTLLAGYPVQ 80 
56420570    2 GREVVIVDAVRTPIGRYKGALKEVRPDDLAAVVIRALIERNPNVPVEQIDDVVFGNANQAGEDNRNVARMAALLAGLPIE 81 
138895567   2 GREVVIVDAVRTPIGRYKGALKEVRPDDLAAVVIRALIERNPNLPVEQIDDVVFGNANQAGEDNRNVARMAALLAGLPKE 81 
51891858    1 MAEAVIVDAVRTPIGRYGGALRDVRPDDLAAVVIRALLQRNPAVSPGSIDDVYLGCANQAGEDNRNVARMAALLAGLPVT 80 
15612768   81 VAATTLNRLCGSGLDAVAYAARMIAVGEGEIVIAGGTESMTRAPYVMEKPGQSYMRGDQTLYDTTIGWRFVHPVMEETYG 160
56420570   82 VAGVTVNRLCGSGLDAVNYAARAILANEADIMIAGGVESMTRAPFVMAKPSSDFPRGNIEMYDTTIGWRFINPKMHEMYG 161
138895567  82 VAGVTINRLCGSGLDAVNYAARAIFADEADIMIAGGVESMTRAPFVMAKPSSDFPRGNIEMYDTTIGWRFINPKMQEMYG 161
51891858   81 VPGVTVNRLCGSGLEAVAQAARAVWCGEGEVLVAGGTESMTRAPFVMAKPAVPWAR-QVEVYDTTLGWRFVNPRLAERYP 159
15612768  161 VDSMPETAENVAKTYSISRLAQDHFAYVSQMRAKEAMECGRLDEELVPVEIEDKKNGKYEVRTDEHPRPTSTMEKLNSLS 240
56420570  162 TDSMPQTAENVAKRFGITREAQDEFAYESQMKAKQAIETNRFADELVPVVYHDRKGNRVVVDKDEHPRPDTTLEKLAKLP 241
138895567 162 TDSMPQTAENVAKRFGITREAQDEFAYESQMKAKRAMETNRFADELVPVVYYDRKGNRIVVDKDEHPRPDTTLEKLAKLP 241
51891858  160 PISLGETAERVAERWNVTREDQDRFAWQSQMRCAAAVREGRFDAEIVPVPVPGEDGRTELVVRDEHPRPDITLERLARLR 239
15612768  241 PLF-ENGTVTAGNASGINDGAAAVLLMSRKKANELGLTPLASYIGAATAGVEPRIMGIGPVYATNKLLNRIGWTVNGLDL 319
56420570  242 PLF-ENGTVTAGNSSGVNDGAAALLVMSAEKAKELGLKPLAVYVTSAVAGVEPAVMGIGPIFATRKALRRAGLSLDDIGL 320
138895567 242 PLF-ENGTVTAGNASGVNDGAAALLLMSADKAKALGLKPLAKYVTSAVAGVEPAVMGIGPIFATRKALRRAGLSVDDIGL 320
51891858  240 PVFrENGTVTAGNASGINDGASALLIMSGKRAAALGLVPMARIVATAVVGVDPSIMGMGPVPATRKALQRAGLTVDQIDL 319
15612768  320 IELNEAFAAQALACIHELGLNQEVVNVNGGAIAYGHPLGASGARILTTLLYEMRRRGSRKGLATMCIGVGQGISVAVERI 399
56420570  321 VELNEAFASQALECIRQLELDRAKVNVNGGAIALGHPLGASGARILTTLIYEMRKRGVTYGLATMCIGVGQGIATIVKNA 400
138895567 321 VELNEAFASQALECIRQLELDREKVNVNGGAIALGHPLGASGARILTTLIYEMQKRGVTYGLATMCIGVGQGIATIVKNA 400
51891858  320 VELNEAFAAQALACIRELGLDPARVNVNGGAIALGHPLGCSGARILTTLVHEMVRRGSRYGLATMCIGVGQGIAMIVEAI 399
15612768  400 D 400
56420570  401 D 401
138895567 401 D 401
51891858  400 R 400
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap