Conserved Protein Domain Family
PRK08188

?
PRK08188: PRK08188 
ribonucleotide-diphosphate reductase subunit alpha; Validated
Statistics
?
PSSM-Id: 236179
View PSSM: PRK08188
Aligned: 155 rows
Threshold Bit Score: 1441.78
Threshold Setting Gi: 32491359
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
23465252   14 TADTAAEQYDPAHDYHALNAMLNLYDADGKIQFDKDKAAEREYVTGHVATNSKRFASTAERLEYLISNQYYNPAVFNQYS 93 
37525252    1 ----MTFQINAQQDYHALNALLNLYDSEGNIQFDKDKLAIHCYFRQHVNPNTLFFHSLKEKLDFLQQEGYYEINVLEQYD 76 
32491359    1 ---------MHKIDYHALNAMLNLYDKNGLLQIEKDVFAINSYYEQHVLPNKKKFSSLEDRITYLLKEEYYESNVFENYK 71 
189440324  14 TADTAAEQYDPAHDYHALNAMLNLYDADGKIQFDKDKAAEREYVTGHVATNSKRFASTAERLEYLISNQYYNPAVFNQYS 93 
213693324  14 TADTAAEQYDPAHDYHALNAMLNLYDADGKIQFDKDKAAEREYVTGHVAANSKQFASTAERLDYLISNQYYNPDVFAQYS 93 
219682806   1 ----------MTADYHSLNAMLNLYDEDGNIQFDKDHEAVDAFLAEHVAPRMIRFESTRERLRYLVDHHYYEYDVFSKYS 70 
241190382   1 --------------------MLNLYDEDGNIQFDKDHEAVDAFLAEHVAPRMIRFESTRERLRYLVDHHYYEYDVFSKYS 60 
253990648   1 ----MTSKINKQRDYHALNAMLNLYDSEGNIQFDKDKLAIYHYFHQHVNQNTIFFHDLKEKLDFLQQEGYYETKVLEQYD 76 
283782687  24 TASTTAERIRNSRDYHVLNAMLGLFDPEKGIQFDKDQEAEKLYVSGYVQEHSMKFASTRERLNYLIDNYYYNGNVFNKYS 103
296455121  14 TADTAAEQYDPAHDYHALNAMLNLYDADGKIQFDKDKAAEREYVTGHVATNSKRFASTAERLEYLISNQYYNPAVFNQYS 93 
23465252   94 AEFLDRIYEHVESAGFEFGTFLGAFKFYTSYALKTFDGRLYLEDFPQRCAAVALELAAGNEQQAIEYADEMLAGRFQPAT 173
37525252   77 FTVIKKLFQQAYSKKFRFQTFLGAFKYYTSYTLKTFDNKRYLERYEDRVCMVALTLAQGDQMLACRLVDEMISGRFQPAT 156
32491359   72 KDFIKNIFFQSKKQGFKFKTFMGAIKFYSSYALKTFDNKYYLEDFEDRACMVALTLGGGNEKFAINIMQEILSGRFQPAT 151
189440324  94 AEFLDRIYEHVESAGFEFGTFLGAFKFYTSYALKTFDGRLYLEDFPQRCAAVALELAAGNEQQAIEYADEMLAGRFQPAT 173
213693324  94 AEFLDRFYEHVESAGFEFGTFLGAFKFYTSYALKTFDGRLYLEDFPQRCAAVALELAAGNEAQATEYADEMLAGRFQPAT 173
219682806  71 PEFLDAFYAHADALPHRFETFLGAFKFYRSYALKTFDGEHYLEDFPQRAAAVSLALADGDEPMAMRTLDEIVLGRFQPAT 150
241190382  61 PEFLDAFYAHADALPHRFETFLGAFKFYRSYALKTFDGEHYLEDFPQRAAAVSLALADGDEPMAMRTLDEIVLGRFQPAT 140
253990648  77 FAFIKKLFQQAYSKKFRFQTFLGAFKYYTSYSLKTFDNKRYLERYEDRVCMVALTLAQGNQTLACRLVDEIISGRFQPAT 156
283782687 104 DEFLDKFYEHAEAAHHTFGTFLGAFKFYTSYALKTFDGKQYLENFAQRAAAVALELADGDEKAATNYLDEMLAGRFQPAT 183
296455121  94 AEFLDRIYEHVESAGFEFGTFLGAFKFYTSYALKTFDGRLYLEDFPQRCAAVALELAAGNEQQAIEYADEMLAGRFQPAT 173
23465252  174 PTFLNLGKAQRGEPVSCFLVRIEDNMESISRGINAALQLSKRGGGVALLLSNLRELGAPIKHIENQSSGVIPVMKLLEDS 253
37525252  157 PTFLNCGKKQRGELVSCFLLRIEDNMESIGRSVNSALQLSKRGGGVAFLLSNLRETGAPIKMIQNQSSGVIPVMKMLEDA 236
32491359  152 PTFLNCGKKQRGEYVSCFLLRIEDNMESIGRALNSALQLSKRGGGVSFLLTNLRESGAPIKCIKNQSSGIVPVMKMLEDA 231
189440324 174 PTFLNLGKAQRGEPVSCFLVRIEDNMESISRGINAALQLSKRGGGVALLLSNLRELGAPIKHIENQSSGVIPVMKLLEDS 253
213693324 174 PTFLNLGKAQRGEPVSCFLVRIEDNMESISRGINAALQLSKRGGGVALLLSNLRELGAPIKHIENQSSGVIPVMKMLEDS 253
219682806 151 PTFLNLGKAQRGEPVSCFLVRIEDNMESISRGINAALQLSKRGGGVALLLSNLREEGAPIKHIENQSSGVVPVMKLLEDS 230
241190382 141 PTFLNLGKAQRGEPVSCFLVRIEDNMESISRGINAALQLSKRGGGVALLLSNLREEGAPIKHIENQSSGVVPVMKLLEDS 220
253990648 157 PTFLNCGRKQRGELVSCFLLRIEDNMESIGRSINSALQLSKRGGGVACLLSNLREAGAPIKMIENQSSGVVPVMKMLEDA 236
283782687 184 PTFLNLGKAQRGEAVSCFLVRLEDNMESIARGINSALQLSKRGGGVALLLTNLRELGAPIKRIENQSSGVVPVMKLLEDS 263
296455121 174 PTFLNLGKAQRGEPVSCFLVRIEDNMESISRGINAALQLSKRGGGVALLLSNLRELGAPIKHIENQSSGVIPVMKLLEDS 253
23465252  254 FSYANQLGARQGAGAVYLNAHHPDILRFLDTKRENADEKIRIKSLALGVVIPDITFELAKQKAQMALFSPYDVERVYGKP 333
37525252  237 FSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSIGVVIPDITFKLAKHNEDMYLFSPYDIQRVYGVP 316
32491359  232 FSYANQLGARQGAGAVYLHAHHPDILNFLDTKRENADEKIRIKTLSLGVIIPDITFKLAKENQNMCLFSPYDIKKVYNKP 311
189440324 254 FSYANQLGARQGAGAVYLNAHHPDILRFLDTKRENADEKIRIKSLALGVVIPDITFELAKQKAQMALFSPYDVERVYGKP 333
213693324 254 FSYANQLGARQGAGAVYLNAHHPDILRFLDTKRENADEKIRIKSLALGVVIPDITFELAKQKAQMALFSPYDVERVYGKS 333
219682806 231 FSYANQLGARQGAGAVYLHAHHPDILKFLDTKRENADEKIRIKSLALGVVIPDITFELAKRREKMALFSPYDVERVYGVP 310
241190382 221 FSYANQLGARQGAGAVYLHAHHPDILKFLDTKRENADEKIRIKSLALGVVIPDITFELAKRREKMALFSPYDVERVYGVP 300
253990648 237 FSYANQLGARQGAGAVYLNAHHPDILHFLDTKRENADEKIRIKTLSLGVVIPDITFELAKNNEDMYLFSPYDIQRVYGVP 316
283782687 264 FSYANQLGARQGAGAVYISAHHPDIMRFLDAKRENADEKIRIKSLSLGVVIPDITFELAKRKEKMALFSPYDVEREYGKP 343
296455121 254 FSYANQLGARQGAGAVYLNAHHPDILRFLDTKRENADEKIRIKSLALGVVIPDITFELAKQKAQMALFSPYDVERVYGKP 333
23465252  334 FADISVTEHYDEMVADDRIKKTYIDARKFFTTIAELQFESGYPYIVFEDTVNRANPIEGRVTMSNLCSEILQVQEPSAYN 413
37525252  317 MSEISMTEKYAEMVNNQQIRKSKINAREFFMALAELQFESGYPYIMYEDTVNNANPIKGRINMSNLCSEILQVNSASEYE 396
32491359  312 FSELIISKIYYKLINDIRIKKISINARSFFQKLAEVQFESGYPYIMFEDTVNKENPIYGKINMSNLCSEILQVNTASEYN 391
189440324 334 FADISVTEHYDEMVADDRIKKTYIDARKFFTTIAELQFESGYPYIVFEDTVNRANPIEGRVTMSNLCSEILQVQEPSAYN 413
213693324 334 FADISVSEHYDEMVADDRIKKTYIDARKFFTTIAELQFESGYPYIVFEDTVNRANPIEGRVTMSNLCSEILQVQEPSAYN 413
219682806 311 FADVNVTAKYEEMLADDRIRKTFIDAREFFTTLAEIQFESGYPYLLFEDTANAANPIDGRITMSNLCSEILQVQEPSTYY 390
241190382 301 FADVNVTAKYEEMLADDRIRKTFIDAREFFTTLAEIQFESGYPYLLFEDTANAANPIDGRITMSNLCSEILQVQEPSTYY 380
253990648 317 MSEISITEKYAEMVNNQHIRKSKINAREFFLTLAEIQFESGYPYIMYEDTVNRVNPIKGRINMSNLCSEILQVNSASEYA 396
283782687 344 FADISVTEHYDEMVANPRIHKKYIDAREFFMTIAEIQFESGYPYILFEDTVNRTNPIEGRITMSNLCSEILQTQEASTYN 423
296455121 334 FADISVTEHYDEMVADDRIKKTYIDARKFFTTIAELQFESGYPYIVFEDTVNRANPIEGRVTMSNLCSEILQVQEPSAYN 413
23465252  414 EDLTYAHVGRDISCNLGSLNIAKAMDG-GLGHTVETAIRALTSVAEHTSINAVPSIRRANEEGHAIGLGQMNLHGFLARE 492
37525252  397 EDLSYHHIGKDISCNLGSMNIAHTMDSpDFTLSIETAVRALTAVSDMSHIRSVPSIEKGNQDSHAIGLGQMNLHGYLARE 476
32491359  392 EDLSYKKIGRDISCNLGSLNIAKTMDSsNLGKTVEVAIRCLTAVSDITKINSVSSVVKGNKKSHSIGLGQMNLHGYLARE 471
189440324 414 EDLTYAHVGRDISCNLGSLNIAKAMDG-GLGHTVETAIRALTSVAEHTSINAVPSIRRANEEGHAIGLGQMNLHGFLARE 492
213693324 414 EDLTYAHVGRDISCNLGSLNIAKAMDG-GLAHTVETAIRALTSVAEHTSINAVPSIRRANEEGHAIGLGQMNLHGFLARE 492
219682806 391 EDLSYAHVGRDVSCNLGSLNIARAMDA-GLAGPVETAIRALTAVSQHTHIGAVPSIARANEEGHAIGLGQMNLHGFLARE 469
241190382 381 EDLSYAHVGRDVSCNLGSLNIARAMDA-GLAGPVETAIRALTAVSQHTHIGAVPSIARANEEGHAIGLGQMNLHGFLARE 459
253990648 397 DDLSYRYIGKDISCNLGSMNIAHTMDSpNFALSIETAIRALTAVSDMSHIRSVPSIEKGNQDSHAIGLGQMNLHGYLARE 476
283782687 424 ADLSYSHVGRDISCNLGSLNIAKAMDG-DLGTSVDLAVRALTSVSEHTSIDSVPSIRRGNAEGHAIGLGQMNLHGFLARE 502
296455121 414 EDLTYAHVGRDISCNLGSLNIAKAMDG-GLGHTVETAIRALTSVAEHTSINAVPSIRRANEEGHAIGLGQMNLHGFLARE 492
23465252  493 GIQYGSEEGLDFTDMYFMTVAYHAYRASHALAVEHGRTFASFATSDYAkpagQGNYFDKYTDGrrSLTPRTERVRALFEQ 572
37525252  477 KIHYGSEEGIDFTNIYFYIVTYHALRTSNQIAIERNSYFKGFKDSRYA----NGEFFNKYTEI--TWQPQTKKVSQLFEQ 550
32491359  472 NIFYGSPEAIEFTNFYFYVITYHAIRTSNLLAIERKKTFSGFSRSKYA----NGKFFKKYTKK--TWIPKSDRILNLFNN 545
189440324 493 GIQYGSEEGLDFTDMYFMTVAYHAYRASHALAVEHGRTFASFATSDYAkpagQGNYFDKYTDGrrSLTPRTERVRALFEQ 572
213693324 493 GIHYGSEEGLDFTDMYFMTVAYHAYRASHALAVEHGQAFKSFATSDYAkpagQGNYFDKYTDGrrSLEPRTAKIRELFAK 572
219682806 470 GIRYGSPEALDFTNMYFETVAFHAYRASHALAVENGHAFARFADSAYArqpsDGNYFDKYLDGslDTEPRTGTVRALFER 549
241190382 460 GIRYGSPEALDFTNMYFETVAFHAYRASHALAVENGHAFARFADSAYArqpsDGNYFDKYLDGslDTEPRTGTVRALFER 539
253990648 477 RIYYGSEEGIDFTNIYFYIVAYHALRTSNQIAIERNCYFKGFKDSRYA----SGEFFNKYTER--SWQPQTQKVCQLFEQ 550
283782687 503 HMQYGSEEALDFTDMYFMTVAYHAYKASHALAVERGHAFANFKTSAYAkpagKGNYFDKYTDGsrSLEPKTQKVRDLFAR 582
296455121 493 GIQYGSEEGLDFTDMYFMTVAYHAYRASHALAVEHGRTFASFATSDYAkpagQGNYFDKYTDGrrSLTPRTERVRALFEQ 572
23465252  573 YGIAIPTAADWEALRDAILKDGIYNQNLQAVPPTGSISYINHSTSSIHPIASKIEIRKEGKIGRVYYPAAYMTNDNLGYY 652
37525252  551 AGIKIPNQQDWLELKASIMAHGIYNQNLQAIAPTGSISYINNSTSSIHPIVSRIEIRKDGKTGRVYYPAPFMTNNNLEYY 630
32491359  546 NNIHLPTLKEWKILENSVMKYGLYNQNLQAIPPTGSISYINYSTSSIHPVVSRIEIRKEGKIGRVYYPAPYMTNKNLCYY 625
189440324 573 YGIAIPTAADWEALRDAILKDGIYNQNLQAVPPTGSISYINHSTSSIHPIASKIEIRKEGKIGRVYYPAAYMTNDNLGYY 652
213693324 573 YGIAIPTAANWEALRDAILKDGIYNQNLQAVPPTGSISYINHSTSSIHPIASKIEIRKEGKIGRVYYPAAYMTNDNLEYY 652
219682806 550 FGVRIPTARDWRELQGEILRDGIYNQYLQAVPPTGSISYINHATSSIHPIASKIEIRKEGKIGRMYYPAPYMTNDNLDLY 629
241190382 540 FGVRIPTARDWRELQGEILRDGIYNQYLQAVPPTGSISYINHATSSIHPIASKIEIRKEGKIGRMYYPAPYMTNDNLDLY 619
253990648 551 AGIVIPNQQDWLELKASVITHGIYNQNLQAVPPTGSISYINNSTSSIHPIVSRIEIRKDGKLGRVYYPAPFMTNDNLEYY 630
283782687 583 FNVAIPTVSDWEQLRDEILSDGIYNEYLQAVPPTGSISYINHSTSSIHPIASRIEIRKEGKVGRVYYPAAYMTNDNMQYF 662
296455121 573 YGIAIPTAADWEALRDAILKDGIYNQNLQAVPPTGSISYINHSTSSIHPIASKIEIRKEGKIGRVYYPAAYMTNDNLGYY 652
23465252  653 KDAYEIGWKAIVDTYAEATQHVDQGLSLTLFFPDTATTRDLNKAQIYAWRKGIKTLYYIRIRQQALEGTEVQGCVSCML 731
37525252  631 QDAYEIGPEKIIDTYAIATQHVDQGLSLTLFFKDDATTRDINKAQIYAWRKRIKTLYYIRLKQTALEGTEVQDCVSCSL 709
32491359  626 QDAYEIGPKKIIDTYAAATKHVDQGLSLTLFFRDDATTRDINKAQIYAWKKGIKTLYYVRIRQLTLKGTELFGCVSCSL 704
189440324 653 KDAYEIGWKAIVDTYAEATQHVDQGLSLTLFFPDTATTRDLNKAQIYAWRKGIKTLYYIRIRQQALEGTEVQGCVSCML 731
213693324 653 KDAYEIGWKAIVDTYAEATQHVDQGLSLTLFFPDTATTRDLNKAQIYAWRKGIKTLYYIRIRQQALEGTEVQGCVSCML 731
219682806 630 DDAYEIGWKAIVDTYAEATPHVDQGLSLTLFFPDTVTTRDLNKAQIYAWRKGIKTLYYIRIRQQALEGTEVAGCVSCML 708
241190382 620 DDAYEIGWKAIVDTYAEATPHVDQGLSLTLFFPDTVTTRDLNKAQIYAWRKGIKTLYYIRIRQQALEGTEVAGCVSCML 698
253990648 631 KDAYEIGPEKIIDTYAAATQHVDQGLSLTLFFKDDATTRDINKAQIYAWRKGIKTLYYIRLRQIALEGTEVQGCISCSL 709
283782687 663 KDAYEIGWKAIIDTYAEATQHVDQGLSLTLFFPDTTTTRDLNKAQIYAWRKGIKTLYYIRIRQKALEGTEIEGCVSCTL 741
296455121 653 KDAYEIGWKAIVDTYAEATQHVDQGLSLTLFFPDTATTRDLNKAQIYAWRKGIKTLYYIRIRQQALEGTEVQGCVSCML 731
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap