Conserved Protein Domain Family
PRK08170

?
PRK08170: PRK08170 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 181265
View PSSM: PRK08170
Aligned: 29 rows
Threshold Bit Score: 737.982
Threshold Setting Gi: 119896755
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
27377538    1 MARPVFIVDGSRTPFLKARsGPGPFTPVDLAVQCGRPLLARQPFSPTSFDQVILGCVNVIADEMNPARVAALRLGMGEDM 80 
29653912    1 MAKPIYIVDGARTPFIKARgKPGPFSASDLAVAAGRALLNRQPFDRTDFDEVIMGCIMQSENEANIGRLIALRLGCGKDM 80 
161831312   1 MAKPIYIVDGARTPFIKARgKPGPFSASDLAVAAGRALLNRQPFDRTDFDEVIMGCIMPSENEANIGRLIALRLGCGKDM 80 
154707644   1 MAKPIYIVDGARTPFIKARgKPGPFSASDLAVAAGRALLNRQPFDRTDFDEVIMGCIMPSENEANIGRLIALRLGCGKDM 80 
212212935   1 MAKPIYIVDGARTPFIKARgKPGPFSASDLAVAAGRALLNRQPFDRTDFDEVIMGCIMPSENEANIGRLIALRLGCGKDM 80 
92116665    1 MVRPVYIIDGSRTPFLKARsGPGPFTPVDLAVQCGRPLLARQPFAPDAFDQVILGCVNVIADEMNPARVAALRLGMGEAM 80 
75677175    1 MVRPVYIIDGSRTPFLKARgGPGPFTPVDLAVQCGRPLLARQPFAPEAFDQVILGCVNVIADEMNPARVAALRLGMGEAM 80 
209884362   1 MSRPVYIIDGSRTPFLKAQgGPGPFTPVDLAVQAGRPLLARQPFKSSDFDQVILGCVNVIADEVNPARVAALRLGMGEDM 80 
83646147    8 PSEPVYVVDGARSPFIKAGdRPGPFHAGDLAAQTGAALLLRQPFNAEEIDEVILGNTMAGPEEANIGRVAALRMGCGEAT 87 
110633876  36 GRKPVYLVDGARTPFLRARgKPGPFTPVDLAVQCGRPLLDRLSFGPEEFDLVILGCVNVLADEMNPARVAALRLGMGEAM 115
27377538   81 VAFTVQINCGSGMQSIDTAYRYIREGHADMILAGGTEALSHAPLVWPNSGVRWFAGLATAKGVAAKLAAAFKLRPRYLKP 160
29653912   81 PGWTVQRNCGSGMQAIDSAMKDIALGRADLVLAGGTEAMSRAPLILNEKMVNWLADWQQAKSFRDKFTVMSRLRPHYFKP 160
161831312  81 PGWTVQRNCGSGMQAIDSAMKDIALGRADLVLAGGTEAMSRAPLILNEKMVNWLADWQQAKSFRDKFTVMSRLRPHYFKP 160
154707644  81 PGWTVQRNCGSGMQAIDSAMKDIALGRADLVLAGGTEAMSRAPLILNEKMVNWLADWQQAKSFRDKFTVMSRLRPHYFKP 160
212212935  81 PGWTVQRNCGSGMQAIDSAMKDIALGRADLVLAGGTEAMSRAPLILNEKMVNWLADWQQAKSFRDKFTVMSRLRPHYFKP 160
92116665   81 VAFTVQINCGSGMQSMDTGYRYIRDGNANLILTGGAEALSHAPLVWPQQGVRWFAGVAGAKGIVAKIKAIAKARPPYFKP 160
75677175   81 VAFTVQINCGSGMQSMDTGYRYIRDGDANLILTGGAEALSHAPLVWPQQGVRWFAGVAAAKGIVEKVKAIAKARPPYFKP 160
209884362  81 VAFGVQINCGSGMQSIDTAYRYIQAGQADMILAGGAEALSYSPLVFPQSGVRWFAGLATARTTLAKLAAFFKLRPSYFKP 160
83646147   88 PGYTVHRNCASGMQALDNAAASIADGRSDLILAGGVEAMSHAPVLLREDMLNWLADWRNADSPLEKIKLIPEFETQYVQP 167
110633876 116 RAFTVQINCGSGMQSIDTGFRLIEGGEADLILAGGAEALSHAPLVLSRKAAGWFAQFATAKTAWDRAAALGAFRPDMAKP 195
27377538  161 IIGLERGLTDPITDLNMGQTAEVVGHLFGITRAQSDAYAAESHRRLAHAQGAGFLKgEVETAFSRDGKFFDHDDGVRPDS 240
29653912  161 IIALLRGLTDPVCELIMGQTAEVLAHQFNITREAMDAYALRSHQRLAAAQENGYLK-EIVPLFTDEGKFYDRDDGVRPDT 239
161831312 161 IIALLRGLTDPVCELIMGQTAEVLAHQFNITREAMDAYALRSHQRLAAAQENGYLK-EIVPLFTDEGKFYDRDDGVRPDT 239
154707644 161 IIALLRGLTDPVCELIMGQTAEVLAHQFNITREAMDAYALRSHQRLAAAQENGYLK-EIVPLFTDEGKFYDRDDGVHPDT 239
212212935 161 IIALLRGLTDPVCELIMGQTAEVLAHQFNIIREAMDAYALRSHQRLAVAQENGYLK-EIVPLFTDEGKFYDRDDGVRPDT 239
92116665  161 IIGLERGLTDPITELNMGQTAEVVGHLFGITREQSDAYAVESHKRLAKAQAEGWLKgELETAFARDGKFYDHDDGVRPES 240
75677175  161 VIGLERGLTDPITELNMGQTAEVVGHLFGITREQSDAYAVESHKRLAKAQAEGWLKgELETAFARDGRFYDHDDGVRPDS 240
209884362 161 IIGLERGLTDPVTDLNMGQTAEVIAHLMGITREQADAYAVESHQRLANAQAQGFLKgEVETAFDRKGKYYDHDDGVRPDS 240
83646147  168 VIGLLRGLTDPIVGLNMGQTTEKEAEHFGVSRRSMDEYAALSQQRLAHADGAGYFKeERTSLYSPDGTFFDKDNGMRPDT 247
110633876 196 IIGLERGLTDPITDFSMGQTAEIIGHAFGVTRQAADAYALESHRRLARAQAEGFLKgEVIASVAADGTLYDHDDGVRPDS 275
27377538  241 TAETLAKLRPVFERPWGQVTAGNSSQITDGASWVILASDAAVAKHKLTPKAVIVDSNWAALDPSIMGLGPVMSATPLLAR 320
29653912  240 SLKKLAQLKPIFDRKFGEVTAGNSSQVTDGASLVIVASEKAVKKYRLPVLGRIVDVEWAALAPEVMGLGPVFAATPLLQR 319
161831312 240 SLKKLAQLKPIFDRKFGEVTAGNSSQVTDGASLVIVASEKAVKKYRLPVLGRIVDVEWAALAPEVMGLGPVFAATPLLQR 319
154707644 240 SLKKLAQLKPIFDRKFGEVTAGNSSQVTDGASLVIVASEKAVKKYRLPVLGRIVDVEWAALAPEVMGLGPVFAATPLLQR 319
212212935 240 SLKKLAQLKPIFDRKFGEVTAGNSSQVTDGASLVIVASEKAVKKYRLPVLGRIVDVEWAALAPEVMGLGPVFAATPLLQR 319
92116665  241 SMETLAKLKPVFERPWGQVTAGNSSQITDGACWTILASEDAVIKHGLKPKAMIIDSQWSALDPSIMGLGPTLSVTELLKR 320
75677175  241 SMESLAKLKPVFERPWGQVTAGNSSQITDGACWTILASEDAVIKHGLEPKAMIIDSQWSGLDPSVMGLGPVLSATELLNR 320
209884362 241 SMEKLAKLKPAFERPWGQVTPGNSSQITDGACWTILASEDAVKKYGLKPKARIIDSAWSGLDPTVMGFGPVLSSNRLLKR 320
83646147  248 TAESLARLKPAFD-PFGSVTAGNSSQITDGACWLLLASEQGLKKHGLTPIARLAHTAWAALDPSMMGLGVTLSSTAILKQ 326
110633876 276 SIEKLARLKPVFERPHGRVTPGNSSQITDGASWVVIASEEAIEKYGLTPIARIVDSEWAALDPSVMGLGPTICSTELIKR 355
27377538  321 NNLTIKDVETWELNEAFATQVLGCLAAWNDDKFCREILGLDGAAGEIDRDKLNVDGGAISLGHPVGTSGNRIVLHLVNAM 400
29653912  320 NRLTLEDIDYWEMNEAFAATILACQKAWASEEFCKKYLGLEKAVGQLDEEKLNIDGGAIAIGHPVGTSGARIVLHLLEIL 399
161831312 320 NRLTLEDIDYWEMNEAFAATILACQKAWASEEFCKKYLGLEKAVGQLDEEKLNIDGGAIAIGHPVGTSGARIVLHLLEIL 399
154707644 320 NRLTLEDIDYWEMNEAFAATILACQKAWASEEFCKKYLGLEKAVGQLDEEKLNIDGGAIAIGHPVGTSGARIVLHLLEIL 399
212212935 320 NRLTLEDIDYWEMNEAFAATILACQKAWASEEFCKKYLGLEKAVGQLDEEKLNIDGGAIAIGHPVGTSGARIVLHLLEIL 399
92116665  321 NKLSLHDIETWELNEAFATQVLGCLAAWKDEKFCREVLGLDGAAGTIDRARLNVDGGAVSLGHPVGTSGNRIVLHLVNAM 400
75677175  321 NKLSLQDIETWELNEAFATQVLGCLAAWEDEKFCRDVLGLEGAAGAIDRARLNVDGGAVSLGHPVGTSGNRIVLHLVNAM 400
209884362 321 NNMTIHDIETWEINEAFASQVLACLAAWKDDKFCREVLGLDGAAGEIDRAKLNVDGGAISLGHPVGTSGNRIVLHLVNAM 400
83646147  327 RGWGLDDIDYWEINEAFAGQVLACLNAWADDAYCREQLGLEQALGELDMTRLNVDGGAIGLGHPIGASGARIVLHLIHVL 406
110633876 356 RGLAREDIDLWEINEAFAAQILACLAAWEDEEYCREVLGLSVPFGTVDRDRLNVDGGAISLGHPVGSSGNRIVLHLANAM 435
27377538  401 KRLGTRRGVATECIGGGLGGAMLIEAV 427
29653912  400 KRKKAKRGIAALCIGGGQGGAMLLERE 426
161831312 400 KRKKAKRGIAALCIGGGQGGAMLLERE 426
154707644 400 KRKKAKRGIAALCIGGGQGGAMLLERE 426
212212935 400 KRKKAKRGIAALCIGGGQGGAMLLERE 426
92116665  401 KRLCTRRGIASECIGGGQGGAMLIEMV 427
75677175  401 KRLGTKRGIATECIGGGLGGAMLVEMV 427
209884362 401 HRLGTRRGVATECIGGGLGGAMLIETV 427
83646147  407 RRHQTRRGIASLCIGGGQGGAMLVENI 433
110633876 436 RRLGLKRGIATECIGGGQGGAMLLEVV 462
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap