Conserved Protein Domain Family
PRK08142

?
PRK08142: PRK08142 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 236164
View PSSM: PRK08142
Aligned: 31 rows
Threshold Bit Score: 627.115
Threshold Setting Gi: 222102731
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
197106706   1 MSIRGQAYVMGAFEHPTRDAPEKTTAQLHAESARGALADAGLSFADVDGYFCAGDApGF-----GGLSMVDYMGLrNVRH 75 
148256414   1 MSLKGQAYIVGAYEHPTRHAVDKSLGQLHAEVAAGALADAGLSWQDVDGYFCAGDVpGWdaqgaGPLSMVEYLGL-RLRH 79 
33602522    1 MTRHALAYVAGAYEHPLRHAPDKSVAQLHAESARGALDDAGLSFADVDGYFCAGDA-GL-----GPAYMVDYLNL-TLRH 73 
33599536    1 MAFQHPAFVAGAFEHPTRHAPDKSTAQLHAECARGALADAGLSLEDVDGYFCAADApGG-----IPALMADYLNLrKLRH 75 
33597677    1 MTRHALAYVAGAYEHPLRHAPDKSVAQLHAESARGALDDAGLSFADVDGYFCAGDA-GL-----GPAYMVDYLNL-TPRH 73 
33595246    1 MAFQHPAFVAGAFEHPTRHAPDKSTAQLHAECARGALADAGLSLEDVDGYFCAADApGG-----IPALMADYLNLrKLRH 75 
33591563   10 LSIRGKAYIVGAFEHPLRYAPAHSVAQLHAECALGALADAGLTLADVDGYFCAGDAgA------SPATLVDHMNL-RLRH 82 
86749470    1 MTIRGKAFIAGIYEHPTRHAPDKSIAQLHAEVAKGALEDAGLTKDDIDGYFCAGDApG------GGMAMVDYLGL-KVRH 73 
302383153   1 MTLKGKAYIVGAYEHPTRKAVDRSVAQLLADVARGALADAGLSLSDVDGFFCAGDIpGWsapgtGPFSIVEYLGL-QLRH 79 
114571207   1 MSLRNAACIVGAFEHPTRLAPDMTTPQLHAECAAGALADAGLSLTDVDGYFCATDApGF-----GPISMIDYLGL-DIRH 74 
197106706  76 LDSTEMGGSSYIAHVGHAAQAIAAGKCRVALITLAGRPRNGGNRpgasmRPGGGgtglsdGPPEAGFEHIYGGSTHNTYG 155
148256414  80 LDTTESWGSAYLNHVAHAVQAIAAGKCRVALITQAGRPRAEKVSpeashRQQAQ------TAAEAQFEAPYGPVVTNVYG 153
33602522   74 VDGTEIGGGSYLAQIGHAAHAIAAGKCSVALITLAGRPRSEGQAtgtepRIPGP------DRPSAPWDSAYRWTIGTIYG 147
33599536   76 VDGTESGGCSYIAHVGHAADAIARGKCSVALITLAGKPRSSGQAtgteiRQIPP------ERPAAAFEQPYAWTVAGMYG 149
33597677   74 VDGTEIGGGSYLAQIGHAAHAIAAGKCSVALITLAGRPRSEGQAtgtepRIPGP------DRPSAPWDSAYRWTIGTIYG 147
33595246   76 VDGTESGGCSYIAHVGHAADAIARGKCSVALITLAGKPRSSGQTtgteiRQIPP------ERPAAAFEQPYAWTVAGMYG 149
33591563   83 VDGTEIGGGSYLALIGHAAQAIASGKCRVALITLAGKPRSAGQAtgteaRQPGP------DRPASAWEAPYRWTVAGIYG 156
86749470   74 LDTTDTGGSSYLILLAHAAEAIAAGRCSVALITLAGKPRTGALPp----RPVGA---------EGDFELAYGATTHNVYA 140
302383153  80 LDTTESWGSAYINHVEHAVEAIVAGKCRVALITMAGRPRAEAARp---dRMHGQv----mDTPEFAFEAPYKPVVTNVYG 152
114571207  75 TDSTEMGGCTYIQHVAHAAQAIAMGKCSVALITLAGRPRSEAVQ------RFRP------GAPESAFEQWVGLTNHTSYG 142
197106706 156 MAAMRHMHEYGTTSEQLAWIKVAASHHAQWNEHAFLKNVVTVEEVVNSRMISDPLHLLDCCVVTDGGGALVVTSPEIAKS 235
148256414 154 MCAMRHMHQHGTTAEQLAWIKVAASHHAQHNPHAMLRKVVSVQDVLDSPIVATPLHRLDCCVISDGGGALVVVHPEIARS 233
33602522  148 NFARRHMHEYGTTSEQLAWVKVAASHHAQHNPNALLRKVYTVDDVLGSPMVADPLHRLDCCVITDGGGALVIVAPEVARS 227
33599536  150 LLARRHMHEYGTTMEQLAWVKVAASHHAQHNPHALLRKRYTTEDVLGSPLVADPLRRMDCCVITDGGGALVLVAPHIAAS 229
33597677  148 NFARRHMHEYGTTSEQLAWVKVAASHHAQHNPNALLRKVYTVDDVLGSPMVADPLHRLDCCVITDGGGALVIVAPEVARS 227
33595246  150 LLARRHMHEYGTTMEQLAWVKVAASHHAQHNPHALLRKRYTTEDVLGSPLVADPLRRMDCCVITDGGGALVLVAPHIAAS 229
33591563  157 NFARRHMHEYGTTSEQLAWVKVAASHHAQHNEHALLRKVYSVEDVLASPMIADPLHRLDCCVITDGGGALVLAAPEVARS 236
86749470  141 MCAARHMHDYGTTSEQLAWIKVAASHHAQYNEHAMLRDVVTVEDVLNSPLIADPLHRLDCCVVTDGGGALIVTSEAIARS 220
302383153 153 MVAKRHMYEHGTTSDQLAWIKVAASHHAQHNAHAMLRNVVTVDEVLNSPMVSDPLHRLDCCVISDGGGALVVVHPEVVQG 232
114571207 143 MCAARHMHEFGTTSEQLAWIKVAASHHAQHNPHAMLPKVVTVEDVVTSPMIADPLHRLDCCVTTDGGGALVVVSPEIART 222
197106706 236 LNRPKVRVLGAGEAPKGQMGG-DLDLTYSGAVWSGPRAFEEAGVTPADIKYASIYDSFTITVLIQLEDLGFCAKGEGGRF 314
148256414 234 LTRPLVTPIGTGFAVKHLNGG-YFDILASGAVQTGREAFAQAGVSPSDIQYASLYDSFTITVLVQLENLGFCAAGEGGRF 312
33602522  228 LNRPRIKVVGHGETIRTNNGGhHEDLLVTGAARSAPAAFAQAGVTPADIKYASIYDNFTIMVIMQLEDLGFCPKGEGGRF 307
33599536  230 LARPRVGVRGYAETIRTNEAG-RLDLLQTGAAVTGPRAFEMAGLAPADVKYASVYDNFTIMVALQLEDLGFCAKGEGGRF 308
33597677  228 LNRPRIKVVGHGETIRTNNGGhHEDLLVTGAARSAPAAFAQAGVTPADIKYASIYDNFTIMVIMQLEDLGFCPKGEGGRF 307
33595246  230 LARPRVGVRGYAETIRTNEAG-RLDLLQTGAAVTGPRAFEMAGLAPADVKYASVYDNFTIMVALQLEDLGFCAKGEGGRF 308
33591563  237 LARPRIRVLGCGETIRTNNGGhHADMLHTGAQRSGPAAFAEAGVTPADIKYASVYDNFTIMVIMQLEDLGFCEKGAGGRF 316
86749470  221 LKRPLVRLIGAGEAVKGPRGGqKLDLTYSAGVWSAPPAFEMAGITPKDIKYASIYDSFTITVLMQLEDLGFCKKGEGGKF 300
302383153 233 LKRPLITPTGAGYAIRQLNGG-YFDILKSGGVQSGRQAFEQAGVTPHDIQYASLYDSFTITVLVQLENLGFCAEGQGGRF 311
114571207 223 LNRPVISLLGAGEATKGPSGGlGLDLTVSAAAKSGPRAFAEAGVTPSDIKYASIYDSFTITVLMQLEDLGFCAKGEGGKF 302
197106706 315 VADGNLiSGVGKLPFNTDGGGLCNNHPTNRGGMTKVIEAVRQLRGEAHPKVQAPNCDLAIAHGTGGSLgIRHGSATVILE 394
148256414 313 VADGGLiSGVGRLPVNTDGGGLCSNHPGNRGGMTKVIEAVRQLRGEAHPAVQVRNCRLALAHGTGGQLgARHGSATLILE 392
33602522  308 VADGNLiSGVGRLPFNTDGGGLCNNHPANRGGMTKAIEAVRQLRGEAHPAVQVKNCDLALAAGPGGVYgIGHSHTTVIFE 387
33599536  309 VADGNLiSGVGRLPWNTDGGGMCNNHPQNRGGITKVIEAVRQLRGEAHPAVQVPSCDIALATGPGLVMgAGHAHATVLLE 388
33597677  308 VADGNLiSGVGRLPFNTDGGGLCNNHPANRGGMTKAIEAVRQLRGEAHPAVQVKNCDLALAAGPGGVYgIGHSHTTVIFE 387
33595246  309 VADGNLiSGVGRLPWNTDGGGMCNNHPQNRGGITKVIEAVRQLRGEAHPAVQVPSCDIALATGPGLVMgAGHAHATVLLE 388
33591563  317 VADGNLiSGTGRLPWNTDGGGLCNNHPANRGGITKAIEAVRQLRGEAHPSVQVPNCDLALAAGPGLVFgVGHSHATVILE 396
86749470  301 VADGNLiSGVGKLPFNTDGGGLCSNHPVNRGGMTKILEAVRQLRGEAHPKVQVPNCDLAIAHGTGGMLgIRHAASTCILE 380
302383153 312 VADGGLiSGIGKLPVNTDGGGLCNNHPANRGGMTKVIEAVRQLRGEAHPDVQVPDCRLALAHGTGGQLgGRHGSATLILE 391
114571207 303 VADGNLiSGTGKLPFNTDGGGLCNNHPMFRGGITKVIEAVRQLRGEAAPAVQVPNCDLAVATGIGGSLgARHGAATIILE 382
197106706 395 RE 396
148256414 393 RE 394
33602522  388 RE 389
33599536  389 RV 390
33597677  388 RE 389
33595246  389 RV 390
33591563  397 RE 398
86749470  381 RV 382
302383153 392 RE 393
114571207 383 RQ 384
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap