Conserved Protein Domain Family
PRK08131

?
PRK08131: PRK08131 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 181242
View PSSM: PRK08131
Aligned: 16 rows
Threshold Bit Score: 669.947
Threshold Setting Gi: 218890185
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116051587   1 MLDAYIYAGLRTPFGRHAGALSTVRPDDLAGLLLARLAETSGFAVDDLEDVILGCTNQAGEDSRNLARNALLAAGLPARL 80 
15598785    1 MLDAYIYAGLRTPFGRHAGALSTVRPDDLAGLLLARLAETSGFAVDDLEDVILGCTNQAGEDSRNLARNALLAAGLPARL 80 
152986486   1 MLDAYIYAGLRTPFGRHAGALASVRPDDLAGALLARLAETCGFAVDDLEDVILGCTNQAGEDSRNLARNALLAAGLPARL 80 
218890185   1 MLDAYIYAGLRTPFGRHAGALSTVRPDDLAGLLLARLAKTSGFAVDDLEDVILGCTNQAGEDSRNLARNALLAAGLPARL 80 
169796353   1 MLNAYIYDGLRSPFGRHAGELASIRPDDLAATVIQKLLEKTGVPGADIEDVILGDTNQAGEDSRNVARNALLLAGLPVTV 80 
215483814   1 MLNAYIYDGLRSPFGRHAGELASIRPDDLAATVIQKLLEKTGVPGADIEDVILGDTNQAGEDSRNVARNALLLAGLPVTV 80 
110833844   1 MLDAYIYDGLRTPFGRHGGVLASVRPDDLLAGVIRELVQRNGFAASLYEDVVIGNTNQAGEDARNVARHAGLLAGLPQSV 80 
226939916   1 MLDAYLYAGLRTPFGRHGGALAPVRPDDLAAGVLRELLARHGIPGGEVEDLILGNTNQAGEDSRNIARHVVLLAGLPVSV 80 
93006064    1 MLDAYIYDGLRSPFGRHGGALATVRPDDMIATVMKALVEKHQLPNDIFNEVLIGNTNQAGEDSRNIARNAALLAGLDVKT 80 
71065727    1 MLDAYIYDGLRSPFGRHGGALATVRPDDLIATVMKTLVEKHQLPNDIFDEVLIGNTNQAGEDSRNIARNAALLAGLDVKT 80 
116051587  81 PGQTVNRLCASGLSAVIDAARAISCGEGRLYLAGGAESMSRAPFVMGKAESAFSRTLEVFDSTIGARFANPRLVERYGND 160
15598785   81 PGQTVNRLCASGLSAVIDAARAISCGEGRLYLAGGAESMSRAPFVMGKAESAFSRTLEVFDSTIGARFANPRLVERYGND 160
152986486  81 PGQTINRLCASGLSAVIDAARAISCGEGRLYLAGGAESMSRAPFVMGKAESAFSRALNVFDSTIGARFANPRLVERHGND 160
218890185  81 PGQTVNRLCASGLSAVIDAARAISCGEGRLYLAGGAESMSRAPFVMGKAESAFSRTLEVFDSTIGARFANPRLVERYGND 160
169796353  81 PGQTVNRLCASGLGAVIDSARAITCGEGELYIAGGVESMSRAPFVMGKAESAYSRDAKIYDTTIGSRFPNKKIIAQYGGH 160
215483814  81 PGQTVNRLCASGLGAVIDSARAITCGEGELYIAGGVESMSRAPFVMGKAESAYSRDAKIYDTTIGSRFPNKKIIAQYGGH 160
110833844  81 AGITVNRLCGSGLAATLDAARMVTVGEGELIIAGGTESMSRAPYVMAKAEKAFSREMTVFDSTIGARFPNPKVLKQFGAD 160
226939916  81 PGQTVNRLCASGLAAVIDAARAVSCNEGSLYAAGGVESMSRAPFVLAKPEKAYTRDFTMYDSTIGARFPNPKIIAQYGND 160
93006064   81 PGQTVNRLCASGLSTIIDAARSITCHEGDIFLAGGVESMTRAPFVFAKTEQPFSREFKVFDTTIGSRFPNPIIEKQFGSD 160
71065727   81 PGQTVNRLCASGLSTIIDAARSITCNEGDIILAGGVESMTRAPFVFAKTEQPFSREFKVFDTTIGSRFPNPIIEKQFGSD 160
116051587 161 SMPETGDNVARAFGIAREDADRFAASSQARYQAALEEGFFLGEILPVEVRAGRKGETRLVERDEHPRPQADLAALARLPA 240
15598785  161 SMPETGDNVARAFGIAREDADRFAASSQARYQAALEEGFFLGEILPVEVRAGRKGETRLVERDEHPRPQADLAALARLPA 240
152986486 161 SMPETGDNVARAFGIEREEADRFAAGSQARYQAALASGFFAGEILPVAVRGASRDETLWVEHDEHPRPRVDLAALARLPP 240
218890185 161 SMPETGDNVARAFGIAREDADRFAASSQARYQAALEEGFFLGEILPVEVRAGRKGETRLVERDEHPRPQADLAALARLPA 240
169796353 161 SMPETGDNVAAEFGISREQADLFAAQSQAKYQKAKEEGFFVDEITPIEVFQGKKLPPKLVSEDEHPRPSSTVEALTKLKP 240
215483814 161 SMPETGDNVAAEFGISREQADLFAAQSQAKYQKAKEEGFFVDEITPIEVFQGKKLPPKLVSEDEHPRPSSTVEALTKLKP 240
110833844 161 TMPQTAQNVAHDLGISREDADAFAIQSQQRYEVAREQGFYQQEVLPVTVPQGGKATPLRVADDEHPRPGTCVDKLRQLPA 240
226939916 161 TMPETADNVAHVYGISREDADTFAAASQARYEAARQAGFFADEIVEVSVPTGRKTPPRLVTTDEHPRPESDFAALSRLRP 240
93006064  161 SMPQTGDNVALKYGITREEADKFAAASQAKYQAAKQAGFFNDEITPIMVSQGKKLPEKAIVEDEHPRASSTVEALQKLKP 240
71065727  161 TMPQTGDNVARKYGITREEADKFAAASQAKYQAAKQAGFFDDEITPIMVSQGRKLPEKAIAEDEHPRASSTVEALQKLKP 240
116051587 241 LFAGGVVTAGNASGINDGAAVVLLGDRAIGEREGIRPLARILASASVGVEPRLMGIGPQQAILRALQRAGIDLDEVGLIE 320
15598785  241 LFAGGVVTAGNASGINDGAAVVLLGDRAIGEREGIRPLARILASASVGVEPRLMGIGPQQAILRALQRAGIDLDEVGLIE 320
152986486 241 LFAGGVVTAGNATGINDGAAVLLLGDRAIGEREGVAPLARILASASVGVEPRLMGIGPHLAILRALQRAGIGLDEVGLIE 320
218890185 241 LFAGGVVTAGNASGINDGAAVVLLGDRAIGEREGIRPLARILASASVGVEPRLMGIGPQQAILRALQRAGIGLDEVGLIE 320
169796353 241 LFEGGVVTAGNASGINDGAAALLIGSEAAGQKYGLKPMAKILSAAAAGIEPRIMGAGPIEAIKKAVARAGLTLDDMDIIE 320
215483814 241 LFEGGVVTAGNASGINDGAAALLIGSEAAGQKYGLKPMAKILSAAAAGIEPRIMGAGPIEAIKKAVARAGLTLDDMDIIE 320
110833844 241 IVDGGIITAGNASGINDGAAAVIVGSRRAGVAAGIAPRARVLSGAVAGVAPRVMGLGPVDACNKALARAGLALAQMDVIE 320
226939916 241 LFEGGVVTAGNASGVNDGAAILLVGDRSVEQRFGLKPMARVLSAAAAGVEPRIMGVGPVEAVNKALARAGLTLADMDIIE 320
93006064  241 LNNEGIVTAGNASGINDGAAALIIGSKRAEETLGFKPIAKILSSGAMGVEPNIMGVGPVEAIKLALKRANLTLDDMSIIE 320
71065727  241 LNNEGVVTAGNASGINDGAAALIIGSKQAEEKLGFKPIAKILSSGAMGVEPNIMGIGPVEAIKLALKRADLTLDDMSIIE 320
116051587 321 INEAFAPQVLACLKLLGLDYEDPRVNPHGGAIALGHPLGASGARLVLTAARGLQRIERRYAVVSLCVGLGQGVAMVIERC 400
15598785  321 INEAFAPQVLACLKLLGLDYEDPRVNPHGGAIALGHPLGASGARLVLTAARGLQRIERRYAVVSLCVGLGQGVAMVIERC 400
152986486 321 INEAFAPQVLACLKLLGLDYDDPRVNPHGGAIALGHPLGASGARLALTAARGLQRLERRYAVVSLCVGVGQGVAMVLERC 400
218890185 321 INEAFAPQVLACLKLLGLDYEDPRVNPHGGAIALGHPLGASGARLVLTAARGLQRIERRYAVVSLCVGLGQGVAMVIERC 400
169796353 321 INEAFASQVLSCLKGLNVDFNDPRVNPNGGAIAVGHPLGASGARLALTVARELIRRKKKYAVVSLCIGVGQGLAMVIENV 400
215483814 321 INEAFASQVLSCLKGLNVDFNDPRVNPNGGAIAVGHPLGASGARLALTVARELIRRKKKYAVVSLCIGVGQGLAMVIENV 400
110833844 321 INEAFAAQVLGCCKQLGLAGDDERLNPNGGAIAVGHPLGASGARLVLTAMRQLERTRGRYALLSLCIGVGQGVAMVLERV 400
226939916 321 INEAFASQVLGCLKGLGVAFDDPRVNPNGGAIALGHPLGASGARLALTVARELQRRQQRYAVISLCIGVGQGLAMVIERV 400
93006064  321 INEAFASQVLGCLKGLDIDFDDKRVNPNGGAIAVGHPLGASGARLALSTARELQRTGEKYAVVSLCIGIGQGLAMVIERV 400
71065727  321 INEAFASQVLGCLKGLDIDFDDKRVNPNGGAIAIGHPLGASGARIALSTARELQRTGEKYAVVSLCIGIGQGLAMVIERV 400
116051587 401 R 401
15598785  401 R 401
152986486     -
218890185 401 R 401
169796353 401 S 401
215483814 401 S 401
110833844 401 D 401
226939916     -
93006064      -
71065727      -
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap