Conserved Protein Domain Family
PRK08084

?
PRK08084: PRK08084 
DNA replication initiation factor; Provisional
Statistics
?
PSSM-Id: 181224
View PSSM: PRK08084
Aligned: 118 rows
Threshold Bit Score: 416.772
Threshold Setting Gi: 146312625
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113969917   1 MPLNSPLQLSLPVYLPDDETFNSYYPAaGNDELIQKLRANAEGQGEAAIYVWGPVKSGRTHLMHAACAHANELDRRSFYL 80
gi 114562926   1 MTQNSPRQLSLPVYLPDDETFQSYYPAsGNDELIQKLQASAEGNLASSLYVYGPEKSGRTHLMHAACALANDLERRTLYI 80
gi 294140661   1 MKSNSPLQLSLPVHLPDDETFNSYYPAaGNDELIQSLQACAEGQVHQAVFLWGPVKSGRTHLMHAACAHANDYQRSSFYL 80
gi 119775051   6 VTQHPPLQLSLPVHLPDDETFTSYYPAaGNDELIGALKSAASGDGVQAIYLWGPVKSGRTHLIHAACARANELERRSFYI 85
gi 170726517   1 MKSNSPIQLSLPVHLPDDETFNSYYPAaGNDELIQSLQACAEGSSERSVYLWGPVKSGRTHLMHAACAHANDLQRSSFYL 80
gi 157961790   1 MKSNSPLQLSLPVHLPDDETFNSYYPAtGNDELIQSLQECAEGKSNGAVFLWGPEKSGRTHLMHAACAHANDLGRSSFYI 80
gi 127512766   1 MSPHSPVQLSLPVYLPDDETFNSYYPAaGNDELILSLQASAEGRANKAVYLWGPVKAGRTHLMHATCARANELNRSSFYL 80
gi 157375578   1 MKSNSPLQLSLPVHLPDDETFNSYYPAaGNDELIQSLQACAEGRADRSVFLWGPVKSGRTHLMHAACAHANDLERSSFYL 80
gi 167624256   1 MKSNSPLQLSLPVHLPDDETFNSYYPAaGNDELIQSLQACAEGRAEGAVFLWGPEKSGRTHLMHAACAHANDLGRSSFYI 80
gi 212635540   1 MKSNSPLQLSLPVHLPDDETFNSYYPAaGNDELIQSLQACAEGRAEGAVFIWGPEKSGRTHLMHAACAHANDLNRSSFYI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113969917  81 PLGIHASISTALLEGLEQLDLICIDDVDDIAGHPIWEEAIFDLYNRVAENKRCALVVSGRSAPADAGFLLPDLVSRMQWG 160
gi 114562926  81 PLGIHASISPALFEGLESLELICIDDIEAIAGHPVWEEAIFHLYNRIAEQQDCRLIVNGKASPSETGFLLPDLVSRMQWG 160
gi 294140661  81 PLGIHASISPALLEGLEQLDLICIDDVDAIAGHPLWEEAIFDLYNRVSENNDCSLIVSGSVSPTDSGFGLADLVSRMQWG 160
gi 119775051  86 PLGIHASISTALLEGLEQFDLICIDDVDAVAGHPLWEEAIFDLYNRVAEQKRGSLIVSASASPMEAGFVLPDLVSRMHWG 165
gi 170726517  81 PLGIHASISTALLEGLESLDLICIDDVDAIAGHPLWEEAIFDLYNRVSEHKNCSLIVSASVSPNDSGFTLPDLISRMQWG 160
gi 157961790  81 PLGIHASISTALLEGLEKLDLVCIDDVDAIAGHPLWEEAIFDLYNRISEQKTCSLVVSASVSPSDSGFSLPDLVSRMQWG 160
gi 127512766  81 PLGIHASISTELLEGLEQLDLVCIDDVDAIAGHPLWEEALFDLYNRVAEHKRCALVVSASATASDAGFALPDLVSRMQWG 160
gi 157375578  81 PLGIHASISPMLLEGLEQLDLICIDDVDAIAGHPLWEEAIFDLYNRVSEHDNCSLIVSASVSPNDSGFALPDLVSRMQWG 160
gi 167624256  81 PLGIHASISTALLEGLEKLDLVCIDDVNAIAGHPLWEEAIFDLYNRISEQKTCSLIVSASVSPSDSGFSLPDLVSRMQWG 160
gi 212635540  81 PLGIHASISPALLEGLEKIDLVCIDDVNAIAGHPLWEEAIFDLYNRISEQKTCSLVLSASVSPSETGFALPDLISRMQWG 160
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 113969917 161 LNYQLQPMADDEKLAALQRRAAMRGLQLPEDVGRFLLNRMARDLRTLFDVLDKLDKASLVHQRKLTIPFAKEMLHL 236
gi 114562926 161 LIYQLQPMADDEKLVALQRRAAMRGLQLSDEVGRFLLTRMARDLRTLFDVLDKLDKASMVHQRKLTIPFIKEMLRL 236
gi 294140661 161 LNYQLQPMADEEKLAALQRRAAMRGLQLEDDVGRFLLSRLARDLRTLFDVLDKLDKDSLVHQRKLTIPFVKKMLKL 236
gi 119775051 166 LTYQLQPMMDDEKLAALQRRAAMRGLQLPEDVGRFLLNRMARDLRTLFDVLDRLDKASMVHQRKLTIPFVKEMLRL 241
gi 170726517 161 LNYQLQPMADEEKLAALQRRAAMRGLQLPEDVGRFLLNRLARDLRTLFDVLDRLDKASLVHQRKLTIPFVKEMLRL 236
gi 157961790 161 LNYQLQPMADEEKLAALQRRAAMRGLQLPEDVGRFLLNRLARDLRTLFDVLDRLDKASMVHQRKLTIPFIKEMLRL 236
gi 127512766 161 LTYQLQPMADEEKLAALQRRAAMRGLQLPEDVGRFLLNRLARDLRTLFDVLDRLDKASLVHQRKLTIPFVKEMLRL 236
gi 157375578 161 LNYQLQPMADDEKLAALQRRAAMRGLQLPEDVGRFLLNRLARDLRTLFDVLDRLDKDSLVHQRKLTIPFVKEMLRL 236
gi 167624256 161 LNYQLQPMADEEKLAALQRRAAMRGLQLPEDVGRFLLNRLARDLRTLFDVLDRLDKASMVHQRKLTIPFIKEMLRL 236
gi 212635540 161 LNYQLQPMADDEKLAALQRRAAMRGLQLSEDVGRFLLNRLARDLRTLFDVLDRLDKASMVHQRKLTIPFIKEMLRL 236
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap