Conserved Protein Domain Family
PRK08076

?
PRK08076: PRK08076 (this model, PSSM-Id:103178 is obsolete)
DNA polymerase I; Provisional
Statistics
?
PSSM-Id: 103178
View PSSM: PRK08076
Aligned: 24 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23099618    1 MSNKLVLIDGNSIIYRAFFALPLLNNDKGVYTNGVYGFTTMLLRILEEEKPTHMLVAFDAGKTTFRHSTYKEYKGGRQKT 80
gi 56964474    1 -MKKLVLIDGNSIAYRAFFALPLLNNEKGEYTNAVYGFTTMLLKVLEDEKPSHMLVAFDAGKSTFRHQTYAAYKGTRQKT 79
gi 157693309   3 DKKKLVLVDGNSLAYRAFFALPLLSNDKGVHTNAIYGFAMILMKMLEDEKPTHMLVAFDAGKTTFRHETFKEYKGGRQKT 82
gi 52081410    3 ERKKLVLVDGNSLAYRAFFALPLLSNEKGIHTNAVYGFTTILMKMLEEEKPTHMLVAFDAGKTTFRHKTFKEYKGGRQKT 82
gi 52786786    3 ERKKLVLVDGNSLAYRAFFALPLLSNEKGIHTNAVYGFTTILMKMLEEEKPTHMLVAFDAGKTTFRHKTFKEYKGGRQKT 82
gi 56421265    3 LKKKLVLIDGSSVAYRAFFALPLLHNDKGIHTNAVYGFTMMLNKILAEEEPTHMLVAFDAGKTTFRHEAFQEYKGGRQQT 82
gi 138896291   3 LKKKLVLIDGNSVAYRAFFALPLLHNDKGIHTNAVYGFTMMLNKILAEEQPTHLLVAFDAGKTTFRHETFQEYKGGRQQT 82
gi 16800668    1 -MNKLVLIDGNSIANRAFYALPLLNNDKGVYTNAVYGFAMMLMNVLEKEKPSHVLVAFDAGKTTFRHTTFKGYKGGRQKT 79
gi 16803605    1 -MNKLVLIDGNSIANRAFYALPLLNNDKGVYTNAVYGFAMMLMNVLEKEKPSHVLVAFDAGKTTFRHTTFKGYKGGRQKT 79
gi 46907796    1 -MNKLVLIDGNSIANRAFYALPLLNNDKGVYTNAVYGFAMMLMNVLEKEKPSHVLVAFDAGKTTFRHTTFKGYKGGRQKT 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23099618   81 PPELSEQFPVLKELLDAFSIKYYQLDQYEADDIIGTLSKQADKKDWEVTVISGDKDLLQLVSEQVTVSVTKKGISDIEKY 160
gi 56964474   80 PSELSGQIPMIHQVLDAFSIKRYEVDEYEADDIIGTAATNAAKEGFDVVVITGDKDLLQLVDDRVEVVLTKKGISEVDRY 159
gi 157693309  83 PPELSEQMPFIRELLDAYQVKRYELPQYEADDIIGTLAVEAEKDGFEVKIFSGDKDLTQLSTDHTTVAITKKGITEVEYY 162
gi 52081410   83 PPELSEQLPFIRELLDAYRISRYELENYEADDIIGTLAKSAEKDGFEVKIFSGDKDLTQLATEGTTVAITKKGITDVEYY 162
gi 52786786   83 PPELSEQLPFIRELLDAYRISRYELENYEADDIIGTLAKSAEKDGFEVKIFSGDKDLTQLATEGTTVAITKKGITDVEYY 162
gi 56421265   83 PPELSEQFPLLRELLRAYRIPAYELENYEADDIIGTLAARAEQEGFEVKVISGDRDLTQLASPHVTVDITKKGITDIEPY 162
gi 138896291  83 PPELSEQFPLLRELLKAYRIPAYELDHYEADDIIGTLAARAEQEGFEVKIISGDRDLTQLASRHVTVDITKKGITDIEPY 162
gi 16800668   80 PSELSEQFPFIRELLTAYDIPQYELANYEADDIIGTLTKKAEADGMEVAIITGDRDLTQLASRKTTVYITKKGIADMETN 159
gi 16803605   80 PSELSEQFPFIRELLTAYDIPQYELANYEADDIIGTLTKKAEADGMEVAIITGDRDLTQLASEKTTVYITKKGIADMETN 159
gi 46907796   80 PSELSEQFPFIRELLTAYDIPQYELANYEADDIIGTLTKKAEADGMEVAIITGDRDLTQLASEKTTVYITKKGIADMETN 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23099618  161 TPAYMLEKMEITPDQIIHLKALMGDSSDNIPGVPGVGEKTATKLLKQY-ENLENVYEHIDEISGKKLKENLSNHREDAFM 239
gi 56964474  160 NREKVAERYGLEPKQIIDLKGLMGDSSDNIPGVPGVGEKTALKLLAEF-RDVETVLDSIDAISGKKLKERLQENKDQALL 238
gi 157693309 163 TPAHIEEKYGLRPDQIIDMKGLMGDSSDNIPGVPGVGEKTAIKLLKQF-ETVENLLEHIDEVSGKKLKEKLEEFKEQAVM 241
gi 52081410  163 TPEHVREKYGLTPEQIIDMKGLMGDSSDNIPGVPGVGEKTAIKLLKQF-HTVEELLSSIDEVSGKKLKEKLEEFKEQALM 241
gi 52786786  163 TPEHVREKYGLTPEQIIDMKGLMGDSSDNIPGVPGVGEKTAIKLLKQF-HTVEELLSSIDEVSGKKLKEKLEEFKEQALM 241
gi 56421265  163 TPETVREKYGLTPEQIVDLKGLMGDKSDNIPGVPGIGEKTAVKLLRQF-GTVENVLASIDEIKGEKLKETLRQHREMALL 241
gi 138896291 163 TPETVREKYGLTPEQIVDLKGLMGDKSDNIPGVPGIGEKTAVKLLKQF-GTVENVLASIDEVKGEKLKENLRQHRDLALL 241
gi 16800668  160 TPETLKEKYDLTPSQIIDMKGLMGDSSDNIPGIPGVGEKTALKLLHEFgGTVESVLEHAEEISGKKLKEKVLENKELAIL 239
gi 16803605  160 TPETLKEKYNLTPEQIIDMKGLMGDSSDNIPGIPGVGEKTALKLLHEFgGTVESVLEHAEEISGKKLKEKVLENKELAIL 239
gi 46907796  160 TPETLKEKYNLTPEQIIDMKGLMGDSSDNIPGIPGVGEKTALKLLHEFgGTVESVLEHAEEISGKKLKEKVLENKELAIL 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23099618  240 SKELVTINRESPIEITLENLPYQGFQTSSVVQIFKDLGFQSLLSRVSEETEDDAeQPniEMESIEFDVVENVTKDLFTDN 319
gi 56964474  239 SKKLATIALDVPLAETLDSFEYGGYEYKQVKEAFKELSFHSLLGRIDGNGDEESaPQ--QLTELDFDIVEEPLPEHFSSP 316
gi 157693309 242 SKELATILVEAPIDVSSKDLAYEGPHMDQVISLYKELGFQTLLERLGEAPETDE-QV--EVDALEVKKMTAVTSEMLTDH 318
gi 52081410  242 SKELATITTEAPLEVSLDSLGYEGFDREAVVKIFKDLGFHSLLERIGEEAGEKE-EE--QLEEIDVMIKTDITDDLFASP 318
gi 52786786  242 SKELATITTEAPLEVSLDSLGYEGFDREAVVKIFKDLGFHSLLERIGEEAGEKE-EE--QLEEIDVMIKTDITDDLFASP 318
gi 56421265  242 SKKLAAIRRDAPVELSLDDIVYQGEDREKVVALFKELGFQSFLEKMESPSSEE--EK--PLAKMAFTLADRVTEEMLADK 317
gi 138896291 242 SKQLASICRDAPVELSLDDIVYEGQDREKVIALFKELGFQSFLEKMAAPAAEG--EK--PLEEMEFAIVDVITEEMLADK 317
gi 16800668  240 SKELATINVDSPIECTVESTKYDGYQTEKVIPLLKEMNFTTLLKNIEGDTAEE--AK--ELKELSFEIVTELKEQHFGGK 315
gi 16803605  240 SKELATINVDSPIECTVESTKYDGYQTEKVIPLLKEMNFTTLLKNIEGDTPEE--SK--ELKELSFEIVTELKEQHFGGK 315
gi 46907796  240 SKELATINVDSPIECTVESTKYDGYQTEKVIPLLKEMNFTTLLKNIEGDTPEE--TK--ELKELSFEIVTELKEKHFGGK 315
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23099618  320 DALYIEMLGENYHLIPIEGIAVVNKERASFIPTDIALNSNIFKAWAEDPQKHKIVFDAKRTKVALLRNNINMQGIIFDSL 399
gi 56964474  317 SALVVEVLAENYHQAEIAGMAVANEKGCFYFPTEKAVKSDAFRAFARSQEKKKWLFDAKRAVVALAWHGVDLNGVDFDLQ 396
gi 157693309 319 AALVVEQLGDNYHEADLIGFAIHNENGAFFMTKEDALQSEAFKEWVQDETKKKWVFDSKRAVVALRWHDVDLKGVDNDVL 398
gi 52081410  319 ASLVVEQLGDNYHEAPILGFSIVNEHGAFFIPEETAVQSDCFKEWAEDESKKKWVFDAKRAAVALRWRGIELKGAEFDVL 398
gi 52786786  319 ASLVVEQLGDNYHEAPILGFSIVNEHGAFFIPEETAVQSDCFKEWAEDESKKKWVFDAKRAAVALRWRGIELKGAEFDVL 398
gi 56421265  318 AALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLL 397
gi 138896291 318 AALVVEVMEENYHDAPIVGIALVNEHGRFFMRPETALADSQFLAWLADETKKKSMFDAKRAVVALKWKGIELRGVAFDLL 397
gi 16800668  316 TALYVELENDNYHTANFIGLTVHSSQGTYFFTKETAEKSAVFRNWVESDET-KVVYDAKKTMVAMNRIGFAIKGVTFDIM 394
gi 16803605  316 TALYVELENDNYHTANFIGLTVHSSQGTYFFTKETAESSEAFRKWVESDQT-KVVYDAKKTIVAMNRIGLAISGITFDIM 394
gi 46907796  316 TALYVELENDNYHTANFIGLTVHSSQGTYFFTKETAESSEVFRKWVESDQT-KVVYDAKKTMVAMNRIGLAISGITFDIM 394
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23099618  400 LASYLLNPAENNHDIPAIANRKSRSDVQFDEEVFGKGAKQKVPEADVLNEHVVRKTQLLFDLYPEMEEELGNNEQYELLK 479
gi 56964474  397 MASYLLDPSLSSHEISDIATRKGTGGVAEDEAVYGKGAKRSLPEEAALAEHLCRKANAMFTLKSTLEDELAQNEQLELLK 476
gi 157693309 399 LASYVVNPQKTYEDVASVAKEYGLNIALSDEKVYGKGAKQAIPPEDELKEHLGRKAAAISALHDLTLEALEKNDQHELYE 478
gi 52081410  399 LAAYIINPGHSYDDVASVAKEHQLHIVSADEAVYGKGAKQAVPDEKELADHLARKAKAISLLREKLLDELEENEQLELFE 478
gi 52786786  399 LAAYIINPGHSYDDVASVAKEHQLHIVSADEAVYGKGAKQAVPDEKELADHLARKAKAISLLREKLLDELEENEQLELFE 478
gi 56421265  398 LAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLV 477
gi 138896291 398 LAAYLLNPAQDAGDIAAVAKMKQYEAVRSDEAVYGKGVKRSLPDEQTLAEHLVRKAAAIWALEQPFMDDLRNNEQDQLLT 477
gi 16800668  395 LASYLLNPSDSIDDFTSVAVRHDYTEVETDEAIYGKGAKRSTPEENIVAAHLARKAVAIAELEKRLVDDLEENEQLALME 474
gi 16803605  395 LASYLLNPSDSIDDFTSVAVRHDYTEVETDEAVYGKGAKRSTPEESIVAAHLARKAVAIADLEKRLVDDLEKNEQLALME 474
gi 46907796  395 LASYLLNPSDSIDDFTSVAIRHDYTEVETDEAVYGKGAKRSTPEESIVAAHLARKAVAIADLEKRLVDDLEENEQLALME 474
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23099618  480 ELEMPLALILAEVEHYGVQVDIDKLKDMGEDLKERLSTLEQEVYELAGETFNLNSPKQLGPILFEKLGLPVIKKTKTGYS 559
gi 56964474  477 KLEMPLSVVLGRMEKEGVRVDREQLEEMGKDLSDRLNTLEKAIHKEAGEPFNINSPKQLGVILFEKLGLPPVKKTKTGYS 556
gi 157693309 479 DLELPLALILGEMESLGVKVDIKRLENMGEELTKKLKEYEETIHRLAGETFNINSPKQLGVILFEKLGLPIIKKTKTGYS 558
gi 52081410  479 ALEMPLAHILGEMESIGVQVDVDRLKKMGEELSAKLAEYEKKIHESAGETFNINSPKQLGVILFDKLGLPVVKKTKTGYS 558
gi 52786786  479 ALEMPLAHILGEMESIGVQVDVDRLKKMGEELSAKLAEYEKKIHESAGETFNINSPKQLGVILFDKLGLPVVKKTKTGYS 558
gi 56421265  478 ELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYS 557
gi 138896291 478 KLEQPLAAILAEMEFTGVNVDTKRLEQMGSELAEQLRAIEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYS 557
gi 16800668  475 DLELPLTFVLAQMEMQGVSVDTKRLENMKVELAGRLKTLEESIHSLAGEEFNINSPKQLGVILFEKLELPPVKKTKTGYS 554
gi 16803605  475 DLELPLTFVLAEMEMQGVSVDTDRLEDMKVELGGRLKTLEASIHSLAGEEFNINSPKQLGVILFEKLELPPVKKTKTGYS 554
gi 46907796  475 DLELPLTFVLAEMEMQGVSVDTERLENMKVELAGRLKTLEESIHSLAGEEFNINSPKQLGVILFEKLGLPAVKKTKTGYS 554
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23099618  560 TAADVLEQLENEHDIIPKLLMYRQLGKLQSTYIEGLLKVVRKDTSRIHTRYNQALTQTGRLSSIEPNLQNIPIRLEEGRK 639
gi 56964474  557 TSADVLEKLAGTHPIIEHLLLYRQLGKLYSTYIEGLLKVIDSETGKVHTRFNQALTQTGRLSSTDPNLQNIPIRLEEGRK 636
gi 157693309 559 TSADVLEKLEDKHEIIRSILHYRQIGKLQSTYVEGLMKVTRKDTHKVHTRFNQALTQTGRLSSTDPNLQNIPIRLEEGRK 638
gi 52081410  559 TSADVLEKLRDKHVIIEDILHYRQIGKLQSTYVEGLLKVIKKDSHKVHTRFNQALTQTGRLSSTDPNLQNIPIRLEEGRK 638
gi 52786786  559 TSADVLEKLRDKHVIIEDILHYRQIGKLQSTYVEGLLKVIKKDSHKVHTRFNQALTQTGRLSSTDPNLQNIPIRLEEGRK 638
gi 56421265  558 TSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRK 637
gi 138896291 558 TSADVLEKLAPHHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTGKVHTMFNQALTQTGRLSSAEPNLQNIPIRLEEGRK 637
gi 16800668  555 TAADVLESLSGKHAIIDEILLYRQLGKIQSTYIEGLLKVTDKETHKVHTRFNQTLTQTGRLSSVDPNLQNIPIRLEEGRK 634
gi 16803605  555 TAADVLESLSGKHAIIDEILLYRQLGKIQSTYIEGLLKVTDKETHKVHTRFNQTLTQTGRLSSVDPNLQNIPIRLEEGRK 634
gi 46907796  555 TAADVLESLSGKHAIIDEILLYRQLGKIQSTYIEGLLKVTDKETHKVHTRFNQTLTQTGRLSSVDPNLQNIPIRLEEGRK 634
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23099618  640 IRQAFVPSKDNWIMFAADYSQIELRVLAHIAGDEKLIKAFKEDTDIHTQTAMDVFHVESDEVTSNMRRQAKAVNFGIVYG 719
gi 56964474  637 IRKAFVASKEGWKIVAADYSQIELRVLAHISGDERMKEAFLTGMDIHTKTAMDVFHVKREEVTDLMRRSAKAVNFGIVYG 716
gi 157693309 639 IRQAFVPSKEGWLMFAADYSQIELRVLAHISQDENLIEAFTRDMDIHTKTAMDVFHVSEEEVTSAMRRQAKAVNFGIVYG 718
gi 52081410  639 IRQAFVPSQKGWLIFAADYSQIELRVLAHISKDKNLIEAFTNDMDVHTKTAMDVFHVSEEEVTPAMRRQAKAVNFGIVYG 718
gi 52786786  639 IRQAFVPSQKGWLIFAADYSQIELRVLAHISKDKNLIEAFTNDMDVHTKTAMDVFHVSEEEVTPAMRRQAKAVNFGIVYG 718
gi 56421265  638 IRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYG 717
gi 138896291 638 IRQAFVPSEPDWLIFAADYSQIELRVLAHIADDDNLIEAFQRDLDIHTKTAMDIFHVSEEEVTANMRRQAKAVNFGIVYG 717
gi 16800668  635 IRQVFVPSKPGWKMFSADYSQVELRVLAHISEDENLIYAFKHDYDIHTKTAMDVFHVEQDEVDSLMRRQAKAVNFGIVYG 714
gi 16803605  635 IRQVFVPSKPGWKMFSADYSQVELRVLAHISEDENLIYAFKHDYDIHTKTAMDVFHVEKEEVDSLMRRQAKAVNFGIVYG 714
gi 46907796  635 IRQVFVPSKPGWKMFSADYSQVELRVLAHISEDENLIYAFKHDYDIHTKTAMDVFHVEQDEVDSLMRRQAKAVNFGIVYG 714
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23099618  720 ISDYGLSQNLGITRKEAKKFIERYFNSYPGVKTYMDEIVQEAKHKGFVSTIMKRRRYLPDITSRNFNMRSFAERTAMNTP 799
gi 56964474  717 ISDYGLSQSLGITRKEAKDFIDRYLASYPQVKAYMENVVKEAKEKGYVQTLLARRRYLPELKSRNFNQRSFAERTAMNTP 796
gi 157693309 719 ISDYGLSQNLGITRKEAAAFIERYLTSFKGVKTYMEEIVQEAKQKGYVTTLLKRRRYIPDITSRNFNIKSFAERTAMNTP 798
gi 52081410  719 ISDYGLSQNLGITRKEAAAFIERYFHSFQGVKEYMEETVQEAKQRGYVTTLLSRRRYIPELTSRNFNLRSFAERTAMNTP 798
gi 52786786  719 ISDYGLSQNLGITRKEAAAFIERYFHSFQGVKEYMEETVQEAKQRGYVTTLLSRRRYIPELTSRNFNLRSFAERTAMNTP 798
gi 56421265  718 ISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTP 797
gi 138896291 718 ISDYGLAQNLNITRKEAAEFIERYFASFPGVKQYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERTAMNTP 797
gi 16800668  715 ISDYGLSQNLGITRKEAKDFIDRYFVSYPAVKEYMQDIVRFAKEKGYVETILHRRRYIPEIVSRNFNVRGFAERTAMNTP 794
gi 16803605  715 ISDYGLSQNLGITRKEAKDFIDRYFVSYPAVKEYMQDIVRFAKEKGYVETILHRRRYIPEIVSRNFNVRGFAERTAMNTP 794
gi 46907796  715 ISDYGLSQNLGITRKEAKDFIDRYFVSYPAVKEYMQDIVRFAKEKGYVETILHRRRYIPEIVSRNFNVRGFAERTAMNTP 794
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23099618  800 IQGSAADIIKKAMIDLDHRLKEENLQANVLLQVHDELILEAPENEIDKLKEIVPDVMENTVELDVPLKVDYSFGKSWFDA 879
gi 56964474  797 IQGTAADIIKRAMVKMSEALEETGLKANMLLQVHDELIFEVAPDDVEPLQELVTEVMEQALELDVPLQVDVSSGNSWFDA 876
gi 157693309 799 IQGSAADIIKKAMIDMARRLKEEKLQTNLLLQVHDELIFEAPKEEIAILEKIVPEVMENALQLDVPLKVDFASGPSWYDA 878
gi 52081410  799 IQGSAADIIKKAMIDMADKLKEKNLQAKLLLQVHDELIFEAPEDEIKVLEKLVPEVMEHALELDVPLKVDCASGPSWYDA 878
gi 52786786  799 IQGSAADIIKKAMIDMADKLKEKNLQAKLLLQVHDELIFEAPEDEIKVLEKLVPEVMEHALELDVPLKVDCASGPSWYDA 878
gi 56421265  798 IQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDA 877
gi 138896291 798 IQGSAADIIKKAMIDLAARLKEEQLQARLLLQVHDELILEAPKEEIERLCELVPEVMEQAVTLRVPLKVDYHYGPTWYDA 877
gi 16800668  795 IQGSAADIIKKAMILMSERLKSENLEAKLLLQVHDELIFEAPEAEIAKLEEIVPDVMENAVELSVPLKVDSAFGDTWYDA 874
gi 16803605  795 IQGSAADIIKKAMILMSERLVSEKLEAKLLLQVHDELIFEAPEAEIAKLEEIVPDVMENAVELSVPLKVDSAFGDTWYDA 874
gi 46907796  795 IQGSAADIIKKAMILMSERLVSEKLEAKLLLQVHDELIFEAPEAEIAKLEEIVPDVMENAVELSVPLKVDSAFGDTWYDA 874

                 .
gi 23099618  880 K 880
gi 56964474  877 K 877
gi 157693309 879 K 879
gi 52081410  879 K 879
gi 52786786  879 K 879
gi 56421265  878 K 878
gi 138896291 878 K 878
gi 16800668  875 K 875
gi 16803605  875 K 875
gi 46907796  875 K 875
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap