Conserved Protein Domain Family
PRK08058

?
PRK08058: PRK08058 
DNA polymerase III subunit delta'; Validated
Statistics
?
PSSM-Id: 181214
View PSSM: PRK08058
Aligned: 55 rows
Threshold Bit Score: 447.065
Threshold Setting Gi: 81427956
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 184154765   1 MERELTATALQPEITARFASLIERGTLAHAYLLVGNVNMGTVALATEVALRLFCPHQDDQGhPDRTCPECQRVLSGNHPD 80
gi 116493217   5 KNLTNQAVEKQPEIVKRFNEMIDSQHLSHAYLLTGAGGIGKKDVAQWVAMRLFCIDLQGSM-PCGECEECTRIMSGQHPD 83
gi 29377236    1 MNEAQQLQQMQPLLYKQLQKSFEHGRLAHAYLFEGDTGTGKQEFGLWMAKHVFCTNLVNQQ-PCNECHNCVRINENEHPD 79
gi 81427956    1 -MATLTIEQMQPKLVQQFAQIIARGQLAHGYLLAGAQGVGKMQLAQWLALRLFCQQVNEDSqPCYQCPECQRILTGNHPD 79
gi 116333255   4 ESVVAVAQRLQPQLVTHLMTLIKTKRLAHAYLFNGADGTGRQQVAQTVAMRLFCQNVTDNL-PCGQCSECRRILAGDHPD 82
gi 28377572    5 ESFAQTLAAKQPRLLAAFKHIIAQNHLAHAYLFAGMEGAGQPELAHWIAQRLFCLHINDGE-PDGTCEECVRIANGSHPD 83
gi 254555750   5 ESFAQTLAAKQPRLLAAFKHIIAQNHLAHAYLFAGMEGAGQPELAHWIAQRLFCLHINDGE-PDGTCEECVRIANGSHPD 83
gi 184152976   3 EQGQTRAEKLQPAIITRFQKILSNNELAHAYLFVGPGGSGKMSIAQWLSLRLFCLHPQDNE-PDLTCAECQRILSGNHPD 81
gi 148543569   3 EQGQTRAEKLQPAIITRFQKILSNNELAHAYLFVGPGGSGKMSIAQWLSLRLFCLHPQDNE-PDLTCAECQRILSGNHPD 81
gi 289433516   1 MGLQDELTVMQPVVMKIFSKSVRENRLSHGYLLEGASGTGKKRTALWLAKSLFCLEATETElACGKCANCTRIASHNHPD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 184154765  81 VVVARPEGRQIKVDQVRYLKAEFSKTGVEGEKKVFIIEGAETLTGSAANSLLKFIEEPGPGVYIFLLTPNKNAVLQTVQS 160
gi 116493217  84 VVEIAPDGQSIKVEQVRFLKSEFSKSGVEGARKVFIIEQANKMTTSAANSLLKFIEEPSGEVTAFLLAENRSLMLPTIVS 163
gi 29377236   80 VLRIAPDGQTIKVNQIRELKAEFSKSGVETAKKVFLIQEADKMSTGAANSLLKFLEEPEGQILAILETTSLSRILPTIQS 159
gi 81427956   80 VVEIKPDGKSIKIADIRYLKQEVAKSGMESSQRLFIIEAAETLTASAANSLLKFLEEPAPNVYAILCTSNKNLMLPTILS 159
gi 116333255  83 VVSVVPDGQRIKVDQVRYLKAEFTKSAVEGNQKIFIVDQVERMTTGAANSLLKFIEEPVGNTVALLLTANKNLILPTILS 162
gi 28377572   84 IVTVAPEGQRIHVDQVRYLKAEFSKSAVEGNRKLFIINDAEKMTASAANSLLKFIEEPSGNVTALLLTTNKQLMLPTIIS 163
gi 254555750  84 IVTVAPEGQRIHVDQVRYLKAEFSKSAVEGNRKLFIINDAEKMTASAANSLLKFIEEPSGNVTALLLTTNKQLMLPTIIS 163
gi 184152976  82 IVYAAPEGRQIKVDEIRRLKAEFSKSAVEGNKKIFIIKDADKMTNGAANSLLKFIEEPGAGVYIFMLTTNKSAVLPTIRS 161
gi 148543569  82 IVYAAPEGRQIKVDEIRRLKAEFSKSAVEGNKKIFIIKDADKMTNGAANSLLKFIEEPGAGVYIFMLTTNKSAVLPTIRS 161
gi 289433516  81 VHLLEPDGASIKIDQVRALKQELSKRGMESDRKVVIIYDAEKMTVQSANSLLKFIEEPEGGLLLLFLTTNPAQILPTIQS 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 184154765 161 RCQVIELRPLPSEMVKEQLQEAGVPEYLGPLAAGLGLSAKQGASLMEDDWLPTSVKLVFDWFKEVASGDPLSFVDVQTGF 240
gi 116493217 164 RTEIIELKPLPKDRLIKELTEQNIAETDARILTRLTNDMSEIQTLVDNNWILDAHKALEKWFITATTGDITAFVDVQTRV 243
gi 29377236  160 RCQTLHFQPLVKKTLIDRLIKQGIGEKTATLLAELTNSFEKAVEISQDEWFNEAREIILQWFNYLKSNDLQAFIYVQKKM 239
gi 81427956  160 RLQVIDLANLPKEMVRQQFEEAQILPAQAQLLSHLTSDLTQAQQLLAEDWLMQVVAKITSWAQKVAQKDLESFVTIQTQL 239
gi 116333255 163 RTQIVDFLRVAPQALLTALADAGITPSQRYLLTTLTESVTAAQDLVVDDWLKDAQQAVGQWFSACCTGDERAFVRVQTEL 242
gi 28377572  164 RTQVIEFPPLNAQALQQTFEQAGIAPNQAQMLRGLTNSVTQAQALLADDWLPQAAQALWRWFDQAVKGDPRSFVAVQVNL 243
gi 254555750 164 RTQVIEFPPLNAQALQQTFEQAGIAPNQAQMLRGLTNSVTQAQALLADDWLPQAAQALWRWFDQAVKGDPRSFVAVQVNL 243
gi 184152976 162 RTQVIELPPLKRDALLTVLTEHNIPQSQQQIAVGITDSVAMIEQWQEDNWFESAIKGVIQWYQDTTRNGMLGFVDVQTIL 241
gi 148543569 162 RTQVIELPPLKRDALLTVLTEHNIPQSQQQIAVGITDSVAMIEQWQEDNWFESAIKGVIQWYQDTTRNGMLGFVDVQTIL 241
gi 289433516 161 RLQPVTFKSLTFDSLVDSLTRIGISEQKARIYASITGSTEQAKNFEEDEWFGEARSAVVKLYEGLHHQGTSPLIIIQESW 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 184154765 241 LKQGSDRAKQLVLLDLVTMVWRDALllKNRVtEPERLHFRQWQA-EVAQLIMPSSAQQVLVASELTLEGRHLLDQNISFQ 319
gi 116493217 244 MALAKDRFYQEKILDLMMLYAMDLL--ELKF-DQETITYEANRR-QLQELADQTNVRQLLAVADVLLPLKHQLSQNLNFQ 319
gi 29377236  240 VKVFKEKEQQALSFDLLMVYYRQLL--EESVaTQQAKKVTEEQA----------------ERLALILKARQKWTANVSWQ 301
gi 81427956  240 LPLLTDRSQQKIALNLIGLWYQDLL--NCRCdLAGDLCFSEYRT-QLNTISQQMTAAEIVAQTEFVLTAQRTFEQNVSCQ 316
gi 116333255 243 VPLALNRDRQGVLLDMVVQAWHDALrqQNATlEAASLAFPKVAQ-ASQQVAQRLSIDQLVRVMTLTLATRGQLAGNLNFQ 321
gi 28377572  244 VGLAKDADHQLVMLDLIAALFQDLL--QLHFeVATTALTFGQYQkELAGLTAEVSDEQLIAATELALTAKRQLASNISFQ 321
gi 254555750 244 VGLAKDADHQLVMLDLIAALFQDLL--QLHFeVATTALTFGQYQkELAGLTAEVSDEQLIAATELALTAKRQLASNISFQ 321
gi 184152976 242 QKVATDRDKQQVVLDLITLIWRDTLmvNSGItAANRLHFNNILG-EMGEVVRKYSPQQLLAASQLTLETRHMLEQNISFQ 320
gi 148543569 242 QKVATDRDKQQVVLDLITLIWRDTLmvNSGItAANRLHFNNILG-EMGEVVRKYSPQQLLAASQLTLETRHMLEQNISFQ 320
gi 289433516 241 MPLFKEKDKMALGLELLLLLYRDRL--HLTLdESYEPICTAQKE-MLAQDALRKSLSETTGEIEKILAAKSKLASNMNMQ 317
                        330
                 ....*....|...
gi 184154765 320 NVVEQLTLRLLLV 332
gi 116493217 320 SVVEKATIKICNI 332
gi 29377236  302 NVCEQLVIQMIHP 314
gi 81427956  317 NVLESLTLNLIAV 329
gi 116333255 322 AILEALTLEILTI 334
gi 28377572  322 NVLEGLTLKLWPI 334
gi 254555750 322 NVLEGLTLKLWPI 334
gi 184152976 321 NIVEQLTIRLVQV 333
gi 148543569 321 NIVEQLTIRLVQV 333
gi 289433516 318 LLMEQLVLEIQGR 330
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap