Conserved Protein Domain Family
PRK08041

?
PRK08041: PRK08041 (this model, PSSM-Id:103156 is obsolete)
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 103156
View PSSM: PRK08041
Aligned: 25 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146312940   1 MKDVVIVGALRTAIGCFQGALARHSAVDLGSVVLKALVERSGIAAHEIDEVILGQVLTAGAGQNPARQAALKGGLPNTVS 80 
157148398   1 MKEVVIVGALRTPIGCFQGTLSRHSAVELGSMVVKALMERTGVDVHAIDEVILGQVLTAGAGQNPARQSAIKGGLPNTVS 80 
152971787   1 MKDVVIVGALRTPIGCFQGALSRHSAVELGSVVVKALVEKTGIDPHSVDEVILGQVLTAGTGQNPARQSAIRGGLPNTVS 80 
161506435  11 MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIDRTGVDVNAIDEVILGQVLTAGAGQNPARQSAIKGGLPNTVS 90 
56414966    1 MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAGAGQNPARQSAIKGGLPTTVS 80 
16766321    1 MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAGAGQNPARQSAIKGGLPTTVS 80 
16761797    1 MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAGAGQNPARQSAIKGGLPTTVS 80 
29143281    1 MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAGAGQNPARQSAIKGGLPTTVS 80 
162139553   1 MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAGAGQNPARQSAIKGGLPTTVS 80 
161615960   1 MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAGAGQNPARQSAIKGGLPTTVS 80 
146312940  81 AITINDVCGSGLKALHLATQAIQCGEADVIIAGGQENMSRAPHVLTDSRTGAQLGNSQLLDSLVHDGLWDAFNDYHMGVT 160
157148398  81 AITINDVCGSGLKALHLATQAIQCGEADIVIAGAQENMSRAPHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHMGVT 160
152971787  81 AITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSRAPHVLTDSRTGA-----QLIDSLVHDGLWDAFNDYHMGVT 155
161506435  91 AITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSRAPHVLNDSRTGALPNADNLVDSLVHDGLWDAFNDYHIGVT 170
56414966   81 AITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSRAPHVLNDSRSGALPDADNLVDSLVHDGLWDAFNDYHIGVM 160
16766321   81 AITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSRAPHVLNDSRSGALPDADNLVDSLVHDGLWDAFNDYHIGVT 160
16761797   81 AITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSRAPHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVT 160
29143281   81 AITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSRAPHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVT 160
162139553  81 AITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSRAPHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVT 160
161615960  81 AITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSRAPHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVT 160
146312940 161 AENLAREYGISRELQDDYALNSQHKARAAIDSGRFRDEIVPVKTvRQNGEPLIVDTDEQPRTDASAEGLAKLNPAFETLG 240
157148398 161 AENLAREYGISRELQDAYALSSQQKARAAIDAGRFKAEIVPVVT-QRNGQPVVVDTDEQPRTDASAEGLAQLNPAFDLLG 239
152971787 156 AENLAREFGISRELQDAWALSSQHKARKAIDSGRFRDEIVPVVT-EHNGAARTVDTDEQPRVDASAEGLASLQPTFDRLG 234
161506435 171 AENLAREYGISRELQDAYALSSQQKARAAIDTGRFKDEIVPVVT-QRNGQTVIVDTDEQPRADASAEGLALLHPAFDSLG 249
56414966  161 AENLAREYGISRELQDAYALSSQQKARAAIDTGRFKDEIVPIVT-QRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLG 239
16766321  161 AENLAREYGISRELQDAYALSSQQKARAAIDTGRFKDEIVPIVT-QRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLG 239
16761797  161 AENLAREYGISRELQDAYALSSQQKARAAIDTGRFKDEIVPIVT-QRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLG 239
29143281  161 AENLAREYGISRELQDAYALSSQQKARAAIDTGRFKDEIVPIVT-QRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLG 239
162139553 161 AENLAREYGISRELQDAYALSSQQKARAAIDTGRFKDEIVPIVT-QRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLG 239
161615960 161 AENLAREYGISRELQDAYALSSQQKARAAIDTGRFKDEIVPIVT-QRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLG 239
146312940 241 SVTAGNASSINDGAAAVMMMSESKAEELNLPVLARIKAFASVGVDPALMGIAPVYATRRCLERAGWQLGDVDLIEVNEAF 320
157148398 240 SVTAGNASSINDGAAAVMMMSEAKAQELDLPILARIRAFASVGVDPALMGIAPVYATRRCLERVGWQLADVDLIEANEAF 319
152971787 235 SVTAGNASSINDGAAAVMMMSEAKALELGLPILARIRAFASVGVDPALMGIAPVHATRRCLERAGWRLDDVDLIEANEAF 314
161506435 250 SVTAGNASSINDGAAAVMMMSESKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCLERAGWQLADVDLIEANEAF 329
56414966  240 SVTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCLERAGWQLTEVDLIEANEAF 319
16766321  240 SVTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCLERAGWQLTEVDLIEANEAF 319
16761797  240 SVTAGNASSINDGAAAVMMMSETKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCLERAGWQLTEVDLIEANEAF 319
29143281  240 SVTAGNASSINDGAAAVMMMSETKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCLERAGWQLTEVDLIEANEAF 319
162139553 240 SVTAGNASSINDGAAAVMMMSETKARALGLPVLARIRAFASVGVDPALMGIAPVYATRRCLERAGWQLTEVDLIEANEAF 319
161615960 240 SVTAGNASSINDGAAAVMMMSETKARALGLPVLARIRAFASVGVDPALMGIAPVYATRRCLERAGWQLTEVDLIEANEAF 319
146312940 321 AAQALSVGKMLEWDPRRVNVNGGAIALGHPIGASGCRILVSLVHEMIKRDARKGLATLCIGGGQGVALAIER 392
157148398 320 AAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVSLVHEMVKRNARKGLATLCIGGGQGVALAIER 391
152971787 315 AAQAISVGRVLEWDERRVNVNGGAIALGHPIGASGCRILVSLVHEMIKRDARKGLATLCIGGGQGVALAVER 386
161506435 330 AAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVSLVHEMVKRDARKGLATLCIGGGQGVALTIER 401
56414966  320 AAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVSLVHEMVKRDARKGLATLCIGGGQGVALTIER 391
16766321  320 AAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVSLVHEMVKRDARKGLATLCIGGGQGVALTIER 391
16761797  320 AAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVSLVHEMVKRDARKGLATLCIGGGQGVALTIER 391
29143281  320 AAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVSLVHEMVKRDARKGLATLCIGGGQGVALTIER 391
162139553 320 AAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVSLVHEMVKRDARKGLATLCIGGGQGVALTIER 391
161615960 320 AAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVSLVHEMVKRDARKGLATLCIGGGQGVALTIER 391
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap