Conserved Protein Domain Family
PRK07983

?
PRK07983: PRK07983 
exodeoxyribonuclease X; Provisional
Statistics
?
PSSM-Id: 181186
View PSSM: PRK07983
Aligned: 73 rows
Threshold Bit Score: 394.471
Threshold Setting Gi: 146310438
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157370180   2 NLRVIDTETCGLEGG---VVEVASVDLIDGQIANPMSDLISPDRPIGIEAMAIHHITEQMVEGKPRIAVAIGRYQGSPYY 78
gi 146310438   1 MLRVIDTETTGLEGGpetVVELASVDIVDGVICNPMSDLVKPGVAIGFEAMAIHHITEDMVEGAPLLSEVIGRYLGADAY 80
gi 292488519   1 MFRVIDTETCGLQGG---VVEVASVDVINGQIVNPMSDLISPDRPISRQAIAVHKITEAMVRGKPTIEQAIGRYHGSPFY 77
gi 292899700   1 MFRVIDTETCGLQGG---VVEVASVDVINGQIVNPMSDLISPDRPISRQAIAVHKITEAMVRGKPTIEQAIGRYHGSPFY 77
gi 291617739   2 MLRVIDTETCGLQGG---VVEVASVDVIDGQIVNPMSDLVSPDRPISRQAMAVHRISEAMVMGKPPIEEAILRYHGSPFY 78
gi 259908234   1 MFRVIDTETCGLQGG---VVEVASVDVISGQILNPMSDLISPDRPISRQAMAVHKITEAMVRGKPAIEQAIGRYHGSPFY 77
gi 123442082   2 YFRVIDTETYGLEGG---IVEIASIDVMDGALSNPMSDLVSPDRPISLDAMVIHHITEEMVEGKPRIAVAVRKYQGSPYY 78
gi 300717064   1 MLRVIDTETCGLQGG---IVEVASVDVIDGKIVNPMSDLICPDRPISPHAMAIHRITEAMVADKPPIEHAIGRYHGSPYY 77
gi 188533646   1 MLRVIDTETCGLQGG---IVEVASVDVINGQIANPMSDLISPDRPISRQAMDVHKITEAMVRGKPTIEQAIGRYHGSPYY 77
gi 260598318   1 MLRIIDTETCGLQGG---VVEVASVDIIDGAIVNPMSDLVRPDRPISHQAMAIHKITEAMVADKPYIEDVIPRYHGSPWY 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157370180  79 VAHNAAFDRGVLPEMHGAWICTMKLARNLYPDIK-YGNQYLRYALNLDVQLPQDttLYPHRALYDCYVTAALLQRIIKDS 157
gi 146310438  81 VAHNAKFDKSKLPQIDAPWICTAKLARSLLPEHKsHSNQYLRYSLGLKPEVPEG--LYAHRALYDCYVTAELLLYMGRLA 158
gi 292488519  78 VAHNASFDRRMLPEMHGEWICTMTLARRLWPGLK-YTNESLRQSLQLEVSPPAE--LHAHRALYDCYVTAALLIRIMSFS 154
gi 292899700  78 VAHNASFDRRMLPEMHGEWICTMTLARRLWPGLK-YTNESLRQSLQLEVSPPAE--LHAHRALYDCYVTAALLIRIMSFS 154
gi 291617739  79 VAHNASFDRRMLPEMHGEWICTMTLARQLWPGIK-YGNQALRHSLKLDVTPPAD--LHAHRALYDCYVTAALLIRIMELS 155
gi 259908234  78 VAHNASFDRRMLPEMHGDWICTMTLARRLWPGLK-YTNEALRQSLQLEVSPPAD--LHAHRALYDCYVTAALLMRIMSFS 154
gi 123442082  79 VAHNAPFDRGVLPEMGGQWICTLKLARMLYPDIK-HSNQYLRYALRLNVSVPDN--LYPHRALYDCYVTAALLQRIMRDS 155
gi 300717064  78 VAHNASFDRRMLPEMHGEWICTMTLARGLWPGIK-YSNQALRETLKLEVTPPAD--LHAHRALYDCYVTAALLIRIMDYS 154
gi 188533646  78 VAHNASFDRRMLPEMNGEWICTMTLARRLWPGLK-YGNEALRQALRLDVSPPPE--LHAHRALYDCYVTAALLVRIMTFS 154
gi 260598318  78 VAHNASFDRKVLPEMPGEWICTVKLARRLWPGIR-YSNMGLYKSLKLQVETPAG--LHHHRALFDCYITAALLLEIMKVS 154
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 157370180 158 GWTPEQMAQITDQPVLL-KKFKFGKYRGQEIDRVAQEDPGYLRWMLKSIEDLSPDMKHTLKYYLIG 222
gi 146310438 159 KWTMGEMRAISNNPSLL-NALRFGKHKGVSFAELAKTEPGYLRWLVANSDD--EDVLFTAGHWLNG 221
gi 292488519 155 GWDAAEMLRRMQVKGSV-NCFPFGKYRGQKVDDVAKKDPGYLQWMLKKIPDLKPDLRSAMQRALSE 219
gi 292899700 155 GWDAAEMLRRMQVKGSV-NCFPFGKYRGQKVDDVAKKDPGYLQWMLKKIPDLKPDLRSAMQRALSE 219
gi 291617739 156 GWRADEMSLRSQPAAQRdDVLPFGKYRGQALAVVARKDPGYLKWMLDNVKDLRPPLRQALRKCLSQ 221
gi 259908234 155 GWDAAEMLRRMQVKGSS-SCFPFGKYRGQKVDDVAKKDPGYLQWMLKKIPDLKPDLRSAMQRALSE 219
gi 123442082 156 GWSAEQMAEITQQPQLL-STFKFGKYRGKSIEQIARQDPDYLRWMLASITDLTPDMRHTLTYYLAE 220
gi 300717064 155 GWDAAEMIRRMLVKGSS-TTFPFGKYRGSKIDDVAKRDPGYLKWMLKNIPDLKPDLRSAMERALSA 219
gi 188533646 155 GWDAAEMLRRMQVKGST-NSFPFGKYRGQKVDDVAKKDPGYLQWMLKKIPDLKPDLRSAIERALSE 219
gi 260598318 155 GWTPEEMVNITGRPQLI-ATLPFGKYRGEPVADIAGRDPGYLRWMLNNVKQLNPDLRLTLKHYLDN 219
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap