Conserved Protein Domain Family
PRK07982

?
PRK07982: PRK07982 (this model, PSSM-Id:103132 is obsolete)
DNA polymerase III subunit epsilon; Provisional
Statistics
?
PSSM-Id: 103132
View PSSM: PRK07982
Aligned: 40 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85058570    1 MSTDITRQIVLDTETTGMNKLGVHYEGHRIIEIGAVEVINRRLTGRHFHVYLKPDRLVDPEAFNVHGISDEFLADKPTFA 80
gi 123441273   1 -----------------MNKLGVHYEGHKIIEIGAVEVINRRLTGRNFHVYIKPDRLVDPEAYGVHGISDEFLADKPTFA 63
gi 162419464   1 MIITPTRQIVLDTETTGMNKLGVHYEGHRIIEIGAVEVINRRLTGRNFHVYVKPDRLVDPEAYGVHGISDEFLADKPTFA 80
gi 108806557   1 MIITPTRQIVLDTETTGMNKLGVHYEGHRIIEIGAVEVINRRLTGRNFHVYVKPDRLVDPEAYGVHGISDEFLADKPTFA 80
gi 16121383    1 MIITPTRQIVLDTETTGMNKLGVHYEGHRIIEIGAVEVINRRLTGRNFHVYVKPDRLVDPEAYGVHGISDEFLADKPTFA 80
gi 22126970    1 MIITPTRQIVLDTETTGMNKLGVHYEGHRIIEIGAVEVINRRLTGRNFHVYVKPDRLVDPEAYGVHGISDEFLADKPTFA 80
gi 108813076   1 MIITPTRQIVLDTETTGMNKLGVHYEGHRIIEIGAVEVINRRLTGRNFHVYVKPDRLVDPEAYGVHGISDEFLADKPTFA 80
gi 145598912   1 MIITPTRQIVLDTETTGMNKLGVHYEGHRIIEIGAVEVINRRLTGRNFHVYVKPDRLVDPEAYGVHGISDEFLADKPTFA 80
gi 45442535    1 MIITPTRQIVLDTETTGMNKLGVHYEGHRIIEIGAVEVINRRLTGRNFHVYVKPDRLVDPEAYGVHGISDEFLADKPTFA 80
gi 153948473   1 MIITPTRQIVLDTETTGMNKLGVHYEGHRIIEIGAVEVINRRLTGRNFHVYVKPDRLVDPEAYGVHGISDEFLADKPTFA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85058570   81 DVADEFLHFIRGGELVIHNAPFDIGFMDYEFGMLNRGIAKTDTFCKVTDSLLLARKMFPGKRNSLDALCDRYLIDNSKRT 160
gi 123441273  64 DITPEFLEFIRGAELIIHNAAFDIGFMDYEFRMLQQDIPKTETFCTITDSLLLARRLFPGKRNNLDALCDRYQIDNTKRT 143
gi 162419464  81 DITPEFLDFIRGAELVIHNAAFDIGFMDYEFRMLQQDIPKTETFCTITDSLLMARRLFPGKRNNLDALCDRYQIDNTKRT 160
gi 108806557  81 DITPEFLDFIRGAELVIHNAAFDIGFMDYEFRMLQQDIPKTETFCTITDSLLMARRLFPGKRNNLDALCDRYQIDNTKRT 160
gi 16121383   81 DITPEFLDFIRGAELVIHNAAFDIGFMDYEFRMLQQDIPKTETFCTITDSLLMARRLFPGKRNNLDALCDRYQIDNTKRT 160
gi 22126970   81 DITPEFLDFIRGAELVIHNAAFDIGFMDYEFRMLQQDIPKTETFCTITDSLLMARRLFPGKRNNLDALCDRYQIDNTKRT 160
gi 108813076  81 DITPEFLDFIRGAELVIHNAAFDIGFMDYEFRMLQQDIPKTETFCTITDSLLMARRLFPGKRNNLDALCDRYQIDNTKRT 160
gi 145598912  81 DITPEFLDFIRGAELVIHNAAFDIGFMDYEFRMLQQDIPKTETFCTITDSLLMARRLFPGKRNNLDALCDRYQIDNTKRT 160
gi 45442535   81 DITPEFLDFIRGAELVIHNAAFDIGFMDYEFRMLQQDIPKTETFCTITDSLLMARRLFPGKRNNLDALCDRYQIDNTKRT 160
gi 153948473  81 DITPEFLDFIRGAELVIHNAAFDIGFMDYEFRMLQQDIPKTETFCTITDSLLMARRLFPGKRNNLDALCDRYQIDNTKRT 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85058570  161 LHGALLDAEILADVFLLMTGGQTAMRFAMEGEQEQRDVGETvqIQRVQRVQTSLKVIYASDEEVVAHEQRLDLVQKKGGS 240
gi 123441273 144 LHGALLDAEILAEVYLAMTGGQTSLSFSMEGDQTQNESSED--IQRITRPASGLKIIYATEDEIAAHESRLDLVMKKGGS 221
gi 162419464 161 LHGALLDAEILAEVYLAMTGGQTSLTFSMEGEVSQNNASED--IQRITRPASALKIIYATEDELANHESRLDFVMKKGGS 238
gi 108806557 161 LHGALLDAEILAEVYLAMTGGQTSLTFSMEGEVSQNNASED--IQRITRPASALKIIYATEDELANHESRLDFVMKKGGS 238
gi 16121383  161 LHGALLDAEILAEVYLAMTGGQTSLTFSMEGEVSQNNASED--IQRITRPASALKIIYATEDELANHESRLDFVMKKGGS 238
gi 22126970  161 LHGALLDAEILAEVYLAMTGGQTSLTFSMEGEVSQNNASED--IQRITRPASALKIIYATEDELANHESRLDFVMKKGGS 238
gi 108813076 161 LHGALLDAEILAEVYLAMTGGQTSLTFSMEGEVSQNNASED--IQRITRPASALKIIYATEDELANHESRLDFVMKKGGS 238
gi 145598912 161 LHGALLDAEILAEVYLAMTGGQTSLTFSMEGEVSQNNASED--IQRITRPASALKIIYATEDELANHESRLDFVMKKGGS 238
gi 45442535  161 LHGALLDAEILAEVYLAMTGGQTSLTFSMEGEVSQNNASED--IQRITRPASALKIIYATEDELANHESRLDFVMKKGGS 238
gi 153948473 161 LHGALLDAEILAEVYLAMTGGQTSLTFSMEGEVSQNNASED--IQRITRPASALKIIYATEDELANHESRLDFVMKKGGS 238

                 ....*
gi 85058570  241 CVWRA 245
gi 123441273 222 CLWRM 226
gi 162419464 239 CLWRM 243
gi 108806557 239 CLWRM 243
gi 16121383  239 CLWRM 243
gi 22126970  239 CLWRM 243
gi 108813076 239 CLWRM 243
gi 145598912 239 CLWRM 243
gi 45442535  239 CLWRM 243
gi 153948473 239 CLWRM 243
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap