Conserved Protein Domain Family
PRK07967

?
PRK07967: PRK07967 
3-oxoacyl-(acyl carrier protein) synthase I; Reviewed
Statistics
?
PSSM-Id: 181184
View PSSM: PRK07967
Aligned: 168 rows
Threshold Bit Score: 776.926
Threshold Setting Gi: 290475968
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
241207061   1 MRRVVVTGLGVVSSIGNDAAEVTESLRQAKSGISFSSDFAEHGFKCQVWGSPKLgsaELAELVDRRAMRFLSQGGAWNHV 80 
229589352   1 MRRVVITGLGIVSCLGNDKETVTANLRASRPGIRFNPEYAEMGLRSQVSGSIDL---PLEELIDRKIYRFVGHAAAYAYL 77 
70729126    1 MRRVVITGLGIVSCLGNDKETVSANLRASRPGIRFNPEYAEMGLRSQVSGSIDL---NLEELIDRKIYRFVGHAAAYAYL 77 
167034741   1 MRRVVITGLGIVSCLGNDKETVTENLRNSRPGIRFNPEYKEMGLRSQVSGSIDL---NLEELIDRKVYRFVGHAAAYAYL 77 
26990867    1 MRRVVITGLGIVSCLGNDKATVTENLRNSRPGIRFNPEYKEMGLRSQVSGSIDL---NLEELIDRKVYRFVGHAAAYAYL 77 
148546931   1 MRRVVITGLGIVSCLGNDKATVTENLRNSRPGIRFNPEYKEMGLRSQVSGSIDL---NLEELIDRKVYRFVGHAAAYAYL 77 
170722662   1 MRRVVITGLGIVSCLGNDKATVTENLRNSRPGIRYNPEYKEQGLRSQVSGSIDL---NLEELIDRKVYRFVGHAAAYAYL 77 
71735116    1 MRRVVITGLGIVSCLGNDKETVTANLRANRPGIRFNPEYAEMGLRSQVSGSIDL---NLEELIDRKIFRFVGHAAAYAYL 77 
66045259    1 MRRVVITGLGIVSCLGNDKDTVTANLRANRPGIRFNPEYAEMGLRSQVSGSIDL---NLEELIDRKIFRFVGHAAAYAYL 77 
28869412    1 MRRVVITGLGIVSCLGNDKETVTANLRANRPGIRFNPEYAEMGLRSQVSGSIDL---NLEELIDRKIYRFVGHAAAYAYL 77 
241207061  81 AMKQALADSGLEeKDYAQNERTGIIMGSGGPSTRTLIEAAEITIKnNSPKRIGPFAVPKAMSSTASATLATWFKIHGVNY 160
229589352  78 AMKDAIADSGLS-EDQVSNVRTGLIAGSGGASTLNQMEALDILRE-KGVKRVGPYRVTRTMGSTVSACLATPFAIKGVNY 155
70729126   78 AMKDAIADSGLS-EEQVSNPRTGLIAGSGGASTLNQMEALDILRE-KGVKRVGPYRVTRTMSSTVSACLATPFKIKGLNY 155
167034741  78 AMQDAIKDAGLT-EEQVSNPRTGLVAGSGGASTLNQMEALDTLRE-KGVKRVGPYRVTRTMGSTVSACLATPFKIKGLNY 155
26990867   78 AMQDAIKDAGLT-EEQVSNPRTGLVAGSGGASTLNQMEALDTLRE-KGVKRVGPYRVTRTMGSTVSACLATPFKIKGINY 155
148546931  78 AMQDAIKDAGLT-EEQVSSPRTGLVAGSGGASTLNQMEALDTLRE-KGVKRVGPYRVTRTMGSTVSACLATPFKIKGINY 155
170722662  78 AMQDAIKDAGLT-EEQVSNPRTGLVAGSGGASTLNQMEALDTLRE-KGVKRVGPYRVTRTMGSTVSACLATPFKIKGLNY 155
71735116   78 AMKDAITDSGLT-EEQVSNVRTGLIAGSGGASTLNQMEALDTLRE-KGVKRVGPYRVTRTMGSTVSACLATPFKIKGVNY 155
66045259   78 AMKDAITDSGLT-DEQVSNVRTGLIAGSGGASTLNQMEALDTLRE-KGVKRVGPYRVTRTMGSTVSACLATPFKIKGVNY 155
28869412   78 AMKDAITDSGLS-DDQVSNVRTGLIAGSGGASTLNQMEALDTLRE-KGVKRVGPYRVTRTMGSTVSACLATPFKIKGVNY 155
241207061 161 SISSACSTSAHCIGNAAEMIQWGKQDVMFAGGHEDLDWTMSNLFDAMGAMSSKYNDTPDSASRAYDVNRDGFVIAGGAGV 240
229589352 156 SISSACATSAHCIGTAVEQIQLGKQDIVFAGGGEEEHWSQSFLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGM 235
70729126  156 SIASACATSAHCIGTAMEQIQMGKQDIVFAGGGEEEHWTQSFLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGM 235
167034741 156 SISSACATSAHCIGTALEQIQWGKQDIVFAGGGEEEHWSQSFLFDAMGALSTKRNETPELASRAYDADRDGFVIAGGGGM 235
26990867  156 SISSACATSAHCIGTALEQIQWGKQDIVFAGGGEEEHWSQSFLFDAMGALSTKRNETPELASRAYDADRDGFVIAGGGGM 235
148546931 156 SISSACATSAHCIGTALEQIQWGKQDIVFAGGGEEEHWSQSFLFDAMGALSTKRNETPELASRAYDADRDGFVIAGGGGM 235
170722662 156 SISSACATSAHCIGTALEQIQWGKQDIVFAGGGEEEHWSQSFLFDAMGALSTKRNDTPELASRAYDADRDGFVIAGGGGM 235
71735116  156 SISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEEEHWSQSFLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGM 235
66045259  156 SISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEEEHWSQSFLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGM 235
28869412  156 SISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEEEHWSQSFLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGM 235
241207061 241 LVLEELERAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMRQALATVKG-DVDYVNTHGTSTPVGDSKEIGAIREV 319
229589352 236 VVVEELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQMAMSTVDT-PIDYLNTHGTSTPVGDAKEMEGVRAV 314
70729126  236 VVVEELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMEMAMSTVDT-PIDYLNTHGTSTPVGDVAEMKGVREV 314
167034741 236 VVVEELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALATVDT-PIDYLNTHGTSTPVGDVAEIKGVRAV 314
26990867  236 VVVEELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALSTVDT-PIDYLNTHGTSTPVGDVAEIKGVRAV 314
148546931 236 VVVEELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALSTVDT-PIDYLNTHGTSTPVGDVAEIKGVRAV 314
170722662 236 VVVEELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALATVDT-PIDYLNTHGTSTPVGDVAEIKGVRAV 314
71735116  236 VVVEELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQMALGDINSgDIDYINTHGTSTPVGDAKEMEGVREV 315
66045259  236 VVVEELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMKMALGDIDSgAIDYINTHGTSTPVGDAKEMEGVREV 315
28869412  236 VVVEELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQMALADVDKnDVDYINTHGTSTPVGDAKEMEGVREV 315
241207061 320 FGSKIPHIQSTKSLTGHSLGAAGVQESIYSLLMMQQGFIGESAHITELDPEFEGVPIVRKRIDDAKIDIALSNSFGFGGT 399
229589352 315 FGDKAPAISSTKSLSGHSLGAAGVHEAIYCLLMMEGNFMAGSANIDEIDPVVADMPILTKTVENAKIDTVMSNSFGFGGT 394
70729126  315 FGDKAPAISSTKSLSGHSLGAAGVHEAIYCMLMMEGNFMAGSANIDELDPEVADMPILTKTREDATINTVMSNSFGFGGT 394
167034741 315 FGDKAPKISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSANIDELDPEVADLPILRNTEENAKIDTVMSNSFGFGGT 394
26990867  315 FGDKAPKISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSANIDELDAEVADLPILRKTEENAKIDTVMSNSFGFGGT 394
148546931 315 FGDKAPKISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSANIDELDPEVADLPILRKTEENAKIDTVMSNSFGFGGT 394
170722662 315 FGDKAPKISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSANIDELDPEVADLPILRKTEENAKIDTVMSNSFGFGGT 394
71735116  316 FGAKAPAISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSANIDELDPVVADMPILLKTREDAKLDLVMSNSFGFGGT 395
66045259  316 FGANAPAISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSANIDELDPVVADMPILLKTQEDAKLDLVMSNSFGFGGT 395
28869412  316 FGTNAPAISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSANIDELDPAIADMPILLKTREDAKLDLVMSNSFGFGGT 395
241207061 400 NATLVFQRYNG 410
229589352 395 NATLVLKRWQG 405
70729126  395 NATLVLKRWQG 405
167034741 395 NATLVLKRWEG 405
26990867  395 NATLVLKRWEG 405
148546931 395 NATLVLKRWEG 405
170722662 395 NATLVLKRWTG 405
71735116  396 NATLVLKRWAG 406
66045259  396 NATLVLKRWAG 406
28869412  396 NATLVLKRWAG 406
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap