Conserved Protein Domain Family
PRK07952

?
PRK07952: PRK07952 
DNA replication protein DnaC; Validated
Statistics
?
PSSM-Id: 181180
View PSSM: PRK07952
Aligned: 71 rows
Threshold Bit Score: 382.965
Threshold Setting Gi: 85058708
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85058708   12 FPPMMNIIERLKKIMPKHVQPITTNRDEYFAVVEKISREASQKTVELNRQNRLKYLIGRSGISPLHQDCRFENYQAYTAD 91
gi 146310180   1 MKNVGELMKRLQKMMPANVKPAFTTGEELLAWQKEQGEIRAAALARENRAMKMQRTFNRSGIRPLHQNCSFDNYKVESQG 80
gi 296101131   1 MKNVGDLMKRLQKMMPANVKPAFTTGEELLAWQKEQGEIRAAALARENRAMKMQRTFNRSGIRPLHQNCSFDNYKIETNG 80
gi 116514962   1 ---MNNFLKKLKKIMPKYIKPKFYNDKELLLWNQKQGKKYSQSIIQNNKAIKIQKTLGKSGIKELYMNCSFENYHINHKG 77
gi 27904536    1 MKNHIKFLKRLKCIVPKHIKPKFHNDEELLAWNQEQGRLSSEAILRKNKAMKMQRILGRSGIRELYMNCSFENYHIEHEG 80
gi 15616650    1 MTFYTEFFKRLQRLMPKNIKPKFDNDEDLLAWNQEQGRLSSESIIRENKAMKMQRVLGRSGIRELYMNCSFDNYKIEHDG 80
gi 219681964   1 MTFYTEFFKRLQRLMPKNIKPKFDNDEDLLAWNQEQGRLSSESIIRENKAMKMQRVLGRSGIRELYMNCSFDNYKIEHDG 80
gi 21672316    1 MTFYNEFFKRLQRLMPSNVKPKFESDQDLLAWNQEQGRLSSESILRENKAMKMQRVLGRSGIRELYMNCSFENYKIEHDG 80
gi 219681408   1 MTFYTEFFKRLQRLMPKNIKPKFDNDEDLLAWNQEQGRLSSESIIRENKAMKMQRVLGRSGIRELYMNCSFDNYKIEHDG 80
gi 156935535   1 MKNVTDLMMRLKRLMPPDVKPAFKTGEELIAWQQEQGRIRSEAIERENRAMKMQRTFNRSGIRPLHQNCSFDNYRVENDG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85058708   92 QRAALHQAIAFAKNFGSGFGGFVFSGSCGTGKNHLAAAIGHCLINKGKSVLCITVADLMMRFRSTYEkHAEW---SEEGL 168
gi 146310180  81 QMNALNLSRQYVDEFDGNIASFIFCGKPGTGKNHLAAAICNELLLRGKSVLIITVADIMSAMKDTFT-NRET---TEEQL 156
gi 296101131  81 QMNALAAARQYVDEFDGNIASFIFSGKPGTGKNHLAAAICNELLLRGKSVLIITVADIMSAMKDTFS-NRET---SEEQL 156
gi 116514962  78 HQKVLNASRKYAENFKNSIASFIFSGKPGTGKNHLAAAIGNYLILQGNSVLIITIADLMSYIKETFN-KKNTnsmTEEKL 156
gi 27904536   81 HKKVVIASKEYAHNFNKNMASFIFSGKPGTGKNHLASAIGNYLILNGKSVLIVTVADLMSNIKSTFNgNNNV---TEERL 157
gi 15616650   81 QRKVLKASKRYAEEFNENIASFIFSGKPGTGKNHLASAIGNYLILHGKSILLVTVADLMSNMKGTFSgTSNI---TEENL 157
gi 219681964  81 QRKVLKASKRYAEEFNENIASFIFSGKPGTGKNHLASAIGNYLILHGKSILLVTVADLMSNMKGTFSgTSNI---TEENL 157
gi 21672316   81 QRKVLKAAKRYAEEFNENIASFIFSGRPGTGKNHLASAIGNYLILHGKSILIVTVADLMSNMKGTFSgTSNI---TEENL 157
gi 219681408  81 QRKVLKASKRYAEEFNENIASFIFSGKPGTGKNHLASAIGNYLILHGKSILLVTVADLMSNMKGTFSgTSNI---TEENL 157
gi 156935535  81 QMNAVNKARQYVDAFDGNIASFVFAGKPGTGKNHLAAAICNELLLRGKSVMIITVADIMSAMKDTFG-NRET---SEEQL 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85058708  169 LRELCNVDLLVLDEIGIQHrNSDNTQILINQLVDRRTSHKKPIGMLTNLTGEQISGVLGERVLDRMMMDNGIWINFNWES 248
gi 146310180 157 LNDLSNVDLLVIDEIGVQT-ESRYEKVIINQIVDRRSSSKRPTGMLTNHNIDEMTRLLGERVMDRMKLGNSLYVIFDWES 235
gi 296101131 157 LNDLSNVDLLVIDEIGVQT-ESRYEKVIINQIVDRRSSSKRPTGMLTNHNIDEMTRLLGERVMDRMKLGNSLYVIFDWES 235
gi 116514962 157 LNNFSTIDLLIIDEIGIQL-KSEYEKIIINQIIDRRSSSKKSTGMLSNLTHAGIKNLLGERVIDRMCIGNSLWLTFEWDS 235
gi 27904536  158 LNNLSNVDLLMIDEIGMQI-ESRYEKVIINQIVDRRSSSKRSTGMLSNLDYRGLKILLGERVIDRMRLGNSLWLTFNWDS 236
gi 15616650  158 LHDLSSVDLLMIDEIGMQT-ESRYEKVIINQIVDRRSSSKRSTGMLSNLDHKGMKSLLGERVIDRMRLGNSLWLTFEWDS 236
gi 219681964 158 LHDLSSVDLLMIDEIGMQT-ESRYEKVIINQIVDRRSSSKRSTGMLSNLDHKGMKSLLGERVIDRMRLGNSLWLTFEWDS 236
gi 21672316  158 LHNLSSVDLLMIDEIGMQT-ESRYEKVIINQIVDRRSSSKRSTGMLSNLDHRGMKNLLGERVIDRMRLGNSLWLTFEWDS 236
gi 219681408 158 LHDLSSVDLLMIDEIGMQT-ESRYEKVIINQIVDRRSSSKRSTGMLSNLDHKGMKSLLGERVIDRMRLGNSLWLTFEWDS 236
gi 156935535 157 LKDLSSVDLLVIDEIGMQS-ESRYEKVIINQLVDRRSSSKRPTGMLTNQNMEEMTKLLGERVMDRMRLGNSLWVNFNWDS 235

                 ....*....
gi 85058708  249 YRSKVKCHA 257
gi 146310180 236 FRSRVTGKE 244
gi 296101131 236 YRSRVTGKE 244
gi 116514962 236 YRKNISGNE 244
gi 27904536  237 YRKKIHGNE 245
gi 15616650  237 YRQYVKGNE 245
gi 219681964 237 YRQYVKGNE 245
gi 21672316  237 YRQYVRGDE 245
gi 219681408 237 YRQYVKGNE 245
gi 156935535 236 YRSRVTGKE 244
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap