Conserved Protein Domain Family
PRK07942

?
PRK07942: PRK07942 
DNA polymerase III subunit epsilon; Provisional
Statistics
?
PSSM-Id: 181176
View PSSM: PRK07942
Aligned: 33 rows
Threshold Bit Score: 288.028
Threshold Setting Gi: 148272897
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
29828689    1 MAWHEQLLIGFDLETTGTDPREARIVTGAVIEVKgQEPVGRREWLADPGVEIPADAVAVHGITNERAAAEGGPPDRVAES 80 
68536400    7 PHFDPAHMLSFDLETTGVDPKTARIVTSALVTIK-GRERNDIEMLADPGVEIPQQASDVHGITTEYVREHGQDHGEVLAK 85 
38233670    9 QSFNPAHVLSFDLETTSANPFEARIVTSALVRID-SSGAHPVELLADPGVEIPEAASKVHGISTEYAREHGEPHEAVLKR 87 
25027895   30 AHFDPANMLSFDLETTAANPFEARIVTSAMVTIT-NAGATPLELLADPGVEIPEGATAVHGITTEYAREHGQPHEEVLAE 108
111022071   2 TSWSDRPICAFDLETTGPDPTDARIVSACIAVVD-AHHFESRTWLLDPEVPIPQGASDVHGISTEYARAHGQDYATGYGE 80 
145295382  12 PSFDTTKMLSFDLETTGVNPFDTRIVTSAMVTIT-SKGAEPIELLADPGIEIPEAATAVHGITTEHARANGRPHDEVLAE 90 
172040411  18 AHFNPAHMLSFDLETTGTNPLSARIVTSAMVRIR-GSQVEDVELLADPGVEIPEQASAVHGITTEYAREHGKPHDEVLAE 96 
226364575   2 TSWSDRPICAFDLETTGPDPTDARIVSACIAVVD-AHHFESRTWLLDPEVPIPQGASDVHGISTEYARAHGQDYATGYRE 80 
227832929  11 MNFDATRMLSFDLETTSVKPKEARIVTSALVRID-GREVDKREMLADPGVEIPEEAAKIHGITTEKARAEGRPHEEVLKE 89 
237785839  11 SHFDPSSMLSFDLETTGTNPLQARIVTSALVSIH-GGSANSTELLADPGIEIPESASQIHGISTEYAREHGEPHDDVLHK 89 
29828689   81 LAQTLVGYWRTGVPVVAYNATFDLTLLSAELRRYGLPSLrerldgrDPAPVIDPYTIDRWVDRYRRGKRNLEAVCTEYGV 160
68536400   86 TIEGIRAAWRSGATLIVYNAAYDLSVLRALEPSFT-----------VDGPVFDPYVVDRAKDQYRKGKRTLESVCQHYGV 154
38233670   88 TVDEIYAAWEEGFTLVVYNAPYDLTVLRQLTGDFV-----------VKGPVYDPYLIDRIMDRFRKGKRTLTDLCSVYGV 156
25027895  109 TIRRIQEGWGNNQALIVYNAPYDLTVLRRLSGDFT-----------IDGLVYDPYTVDRIKDPYRKGKRTLADLCAHYEV 177
111022071  81 IREALHDAWTRDHAVVAFNASYDLTVMHTEGLRLGLAEL-------VTGIVVDPYVIDREMDRHRKGRRTLGAVCEHYGI 153
145295382  91 TISRLRAGWQAGLSVIVFNASYDLTVLRNHDPSFT-----------IDGLVYDPFVIDKVKDRYRKGKRTLTDMCAHYDV 159
172040411  97 TIRAIRQGWEEGATLVVFNAPYDLTVLRSQDPSFT-----------VDGPVIDPLLLDRHFDQYRKGKRTLGAVCEHYEV 165
226364575  81 IRDALYDAWTRDHAVVAFNASYDLTVMHTEGLRLGLPEL-------VHGIVVDPYVIDREMDRYRKGRRTLGAVCEHYGI 153
227832929  90 TVDSIYQAWDEGLTLIVYNAAYDLSVLRALTGDFT-----------VNGPVFDPFVIDRVKDKWRKGKRTLEEVSAHYGV 158
237785839  90 TIRAIYDGWERGQTLIVFNAAYDLTILRHLEPSFV-----------CSGLVFDPLVMGRALEPQRTGPRKLGTLVKRYGI 158
29828689  161 PLDAAHDATADALAAARLAAAIAH-RHP-KIAALGPAELHRRQIEWYAAWAADFQSFLRRKGDTAAVVDGTWPLREPADE 238
68536400  155 TLDNAHEATADAVAAARVAWMLAR-KYP-ELTQMSADELMLSQATWFYESQKGLQEWFHKK-GKDVQVNTAWPLAE---- 227
38233670  157 RMDNAHEATSDALAAARIAWMQAKkRFKdDLAAYSHDELMEYQAVQYYELQKDMKKYLDGLGRDTSTVNFGWPMQNSR-- 234
25027895  178 QLGNAHEATSDALAAARIAWKQAR-IWP-ELATMSGEELMEMQAVGYYEKQISFRNYLQGQGRDGSTVNTSWPVQSS--- 252
111022071 154 ALEDAHEAEADAIAAAHLARTLAQ-EYP----NLRALDIMTHQAGWHAERQRDFADYLVRQGRDASDVNGEWPIRGLAEF 228
145295382 160 QLGNAHEATSDALAAARIAWKQVR-LWP-ELTKMTGEELMEFQAVNYYEQQKSFRSYLIGQGRDASDVNTSWPVQTDPAS 237
172040411 166 ALDNAHEATADAIAAARVAWKIAR-EHP-ELTQMSADELMLNQSTWYYEQQSSLAEYFRSK-GRDANVNTSWPLQ----- 237
226364575 154 ALEDAHEAEADALAAAHLARTLAQ-EYP----NLRALDIMTHQADWHAERQRDFVDYLVRQGRDASDVNGEWPIRGLPRS 228
227832929 159 ELSNAHEATADALAAARVAWKQVRqHFP-ELAQMDSNELMEYQAVEWYKDRESFKKYLEGRGRDASDVSTAWPMIS---- 233
237785839 159 QLDNAHNASADALAAARVAWKMAR-MWP-DLVKKTSDELMEFQAVSYFDYQIHLRDYFASQGREMTDFSTAWPMRDGSRT 236
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap