Conserved Protein Domain Family
PRK07910

?
PRK07910: PRK07910 
3-oxoacyl-(acyl carrier protein) synthase II; Reviewed
Statistics
?
PSSM-Id: 236129
View PSSM: PRK07910
Aligned: 34 rows
Threshold Bit Score: 707.264
Threshold Setting Gi: 296392734
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
161579550  22 MTELVTGKTLPNVVVTGIAMTTALATDAETTWKLLLDSQSGIRTLDDPFVEEFDLPVRIGGHLLEEFDSQLTRVELRRTG 101
108797762   1 MAKLRTGSGFGDVVVTAVASTTAVAPDAEDTWQQLLAGHSGIRALDSWFVDELDSPVRIGGQLRENSDAYLNRVELRRLA 80 
126433389   1 MAKLRTGSGFGDVVVTAVASTTAVAPDAEDTWQQLLAGHSGIRALDSWFVDELDSPVRIGGQLRENFDAYLNRVELRRLA 80 
119866852   1 MAKLRTGSGFGDVVVTAVASTTAVAPDAEDTWQQLLAGHSGIRALDSWFVDELDSPVRIGGQLRENSDAYLNRVELRRLA 80 
118471865   1 MVAKTTGNGLPDVVVTAVASTTSLAPHAEDTWKLLLEGRSGIRALDKPFVEEFDSPVRIGGQLTEAFADKLGRVEQHRLS 80 
226307161   2 TSASTRKGKFPDIVVTSLATSTSVAGDVDGTWKALLAGESGIGILDDPFIDEFDLPIRIGGHLKVSPDEGLSRVEIRRMS 81 
54023585    2 TTPSTLNGNFPNVVVTSMAATTSIAGDVDATWKGLLNGESGIDVLEDSFIEEYDLPVRIGGHLKVNPDTLLSRVEIRRMA 81 
226360338   2 TSASTNGRQFPNIVVTSLAATTSIAGDVDATWKGLLAGESGIDTIQEAFVTENELPVTIGGKLKVSPDESLSRVEIRRMS 81 
120405899   1 ------MSRFPDVVVTGVAMTTALGTDVESTWQALLEGRSGIRRLEDSFIEEFDLPVRIGGHLLETFDEQLTPEENWELS 74 
111018213   2 TSASTNGKQFPNIVVTSLAATTSIAGDVDATWKGLLAGESGIDTIREAFVTENDLPVTIGGKLKVSPDESLSRVEIRRMS 81 
161579550 102 YLQRMSTILGRRVWENAGSPEVDSNRLMVSIGTGLGSSEEMVFSYDDMRARGMKAVSPLGVQKYMPNGAAAAVGLEHHAK 181
108797762  81 YMQKMSTVLGRRLWEAAGTPDIDPRRLMVSIGLALGSTEEIPAQYDDWRQKGLRAVSPLAVQMYMPNAPAAAVGLDRQAK 160
126433389  81 YMQKMSTVLGRRLWEAAGTPDIDPRRLMVSIGLALGSTEEIPAQYDDWRQKGLRAVSPLAVQMYMPNAPAAAVGLDRQAK 160
119866852  81 YMQKMSTVLGRRLWEAAGTPDIDPRRLMVSIGLALGSTEEIPAQYDDWRQKGLRAVSPLAVQMYMPNAPAAAVGLDRQAK 160
118471865  81 YMGQMSTVLGRRLWETAGNPEVDTRRLMVSIGMALGTTEELILQYDLWKAKGLRAVPPTAIQKYMPNAPAAAVGLDRKAK 160
226307161  82 WVERLALTLSRTVWSNAGSPEVDQDRLAVVIGTGLGGGDTLIDAVDKLRGGGYRKVSPFSVQMVMPNGPAATVGLELGAR 161
54023585   82 YVERLATVLGREVWKNAGSPEVDPDRLAVAIGTGLGGGDALIDSVDKLKNGGYRKISPLAVQMVMPNGPSACVGLELKAR 161
226360338  82 FVERLALVLGRQVWENAGSPEVDKDRLGVVIGTGLGGGEALIDAVDKMKAGGYRKVSPFAVQMVMPNGPSATVGLELGAR 161
120405899  75 YVQRMAVVLGRRVWENAGSPDVDPNRLTVSIGTGMGGIEELAFAYDHLREHHLELVNPTVVQQYAPSGPSSAVALERHAR 154
111018213  82 FVERLALVLGRQVWENAGSPEVDKDRLGVVIGTGLGGGEALIDAVEKMKAGGYRKVSPFAVQMVMPNGPSATVGLELGAR 161
161579550 182 AGVITPVSACASGSEGIAQAWRNIVFGEADIAICGGVETKIEAVPIAAFAQMRIvMSTKNDDPVGACRPFDRDRTGFVFG 261
108797762 161 GGIISPVMADASGAAAIAQAWRQIVLGEVEMAICGGVETKIEAVPVGAFTRLGL-LSTNNDDPAGACRPFDKDRDGMVLG 239
126433389 161 GGIISPVMADASGAAAIAQAWRQIVLGEVEMAICGGVETKIEAVPVGAFTRLGL-LSTNNDDPAGACRPFDKDRDGMVLG 239
119866852 161 GGIISPVMADASGAAAIAQAWRQIVLGEVEMAICGGVETKIEAVPVGAFTRLGL-LSTNNDDPAGACRPFDKDRDGMVLG 239
118471865 161 AGIMSPIMADASGAAAIAHAWREIILGDADIAICGGVETWIEAVPVGAFSQLGM-LSTYNDDPPAACRPFDKDRDGMVLG 239
226307161 162 GGVITPVSACSSGSEAIAHAHRMLVMGDADMVVAGGVESFIDAVPIASFAMMRA-MSTNNDNPAAASRPFDKDRDGFVFG 240
54023585  162 AGVVTPVSACSSGSEAIANAWRMIVMGDADVVVTGGVEGYIDSVPIAAFSMMRA-MSTRNDDPKGASRPFDKDRDGFVFG 240
226360338 162 AGVITPVSACSSGSEAIAHAYRMLVMGDADIIVAGGVEGYLDAVPIASFAMMRA-LSTRNDDPKAASRPFDKDRDGFVFG 240
120405899 155 AGILAPVSACASGSEGIAQAWRHIIFGEADIAICGGVEARIEAVPIAGFAQMRIvMSTNNDDPPGACRPFDRDRDGFVFG 234
111018213 162 AGVITPVSACSSGSEAIAHAYRMLVMGDADIIVAGGVEGYLDAVPIASFAMMRA-LSTRNDDPKAASRPFDKDRDGFVFG 240
161579550 262 EAGALMVIETEEHAKARGANILARIMGASITSDGYHMVAPDPNGERAGHAMSRAIQLAGLTPGDIDHVNAHATGTSVGDV 341
108797762 240 EGGALLLIETEENAKARGATILGRIMGAAMTSDGYDIVEPDPSGVPAGDAIRHAVDLAGLEPSDVDLVNAHATGTAFGDV 319
126433389 240 EGGALLLIETEENAKARGATILGRIMGAAMTSDGYDIVEPDPSGVPAGDAIRHAVDLAGLEPSDVDLVNAHATGTAFGDV 319
119866852 240 EGGALLLIETEENAKARGATILGRIMGAAMTSDGYDIVEPDPSGVPAGDAIRHAVDLAGLEPSDVDLVNAHATGTAFGDV 319
118471865 240 EAGALMLVETEEHAKARGAPILARLMGAGMTNDCYDIVKPDPDGQLAGDAIRRAIELAGLAPGDIDHINAHATGTDFGDL 319
226307161 241 EAGALMILETEEHAKARGATIHARLLGSGITSDGYHIVAPHPEGLGAARAMTRAIEMAGLTKSDIKHINAHATATPIGDI 320
54023585  241 EAGALMVLETEEHAKARGATIHARLLGAGITSDGYHLVAPDPEGTGAARAMTRAMQSAGLTKQDITHINAHATATPIGDT 320
226360338 241 EAGAMMVLETEEHAKARGATIHARLLGAGITSDGFHIVAPDPSGSGAARAMTRAIETAGLTKKDIQHINAHATATPIGDT 320
120405899 235 EGGALLVIETAEHARARGAKVLGRLMGASITSDGFHMVAPDPNGKRAGYAMSHAVELAGLSATDIDHVNAHATGTTVGDV 314
111018213 241 EAGAMMVLETEEHAKARGATIHARLLGAGITSDGFHIVAPDPSGSGAARAMTRAIETAGLTKTDIQHINAHATATPIGDT 320
161579550 342 AESKAINNALGphGGNAAVYAPKAALGHSVGAVGAVESILTVLALRDQVVPPTLNLENLDPEIDLDVVAGKPRPGNYQYA 421
108797762 320 AEGCAIRHALG--AHRPAVYAPKAALGHSLGAAGAVEAVLTVQALRDGVVPPTLNVQHLDADIDLDVVTGEPRRGDFRYA 397
126433389 320 AEGCAIRHALG--AHRPAVYAPKAALGHSLGAAGAVEAVLTVQALRDGVVPPTLNVQHLDADIDLDVVTGEPRSGDFRYA 397
119866852 320 AEGCAIRHALG--AHRPAVYAPKAALGHSLGAAGAVEAVLTVQALRDGVVPPTLNVQHLDADIDLDVVTGEPRRGDFRYA 397
118471865 320 AEARAIHNVLG--SHRPSVYASKAALGHSLGSAGAVEAVLTVQTLRDGIVPATLNVKNPDPQIDLDVVTDQPRSEHYRYA 397
226307161 321 AEAKAINAAVG---NHAAVYGPKSALGHSIGAVGALESVLTVLAVRDGIIPPTLNVDSQDPEIDLDVVKGEPRTGSFDFA 397
54023585  321 AEANAINKAVG---NHPSVYAPKSALGHSIGAVGALESVLTVLSIRDGIVPPTLNLDNQDPEIDLDVVKGEARRQEIEYA 397
226360338 321 AEANAIKAAVG---NHAAVYAPKSALGHSIGAVGALEAVLTVLSLRDGVIPPTLNLENQDPEIDLDVVKGEARYGEIDFA 397
120405899 315 AEGVAINYALG--GHKPAVYAPKGALGHSVGAVGAVESILTLLALRDGVIPATRNLKNLDPEIDLDVVAGEPRHGDFKYA 392
111018213 321 AEANAIKAAVG---NHAAVYAPKSALGHSIGAVGALEAVLTVLSLRDGVIPPTLNLENQDPEIDLDVVKGEARYGEIDFA 397
161579550 422 INNSFGFGGHNVAIAFGRY 440
108797762 398 VSNSFGLGGHNIVLVFGAY 416
126433389 398 VSNSFGLGGHNIVLVFGAY 416
119866852 398 VSNSFGLGGHNIVLVFGAY 416
118471865 398 LSNSFGLGGNNVVLAFGAA 416
226307161 398 LNNSFGFGGHNVALAFGRA 416
54023585  398 INNSFGFGGHNVALAFGRA 416
226360338 398 INNSFGFGGHNVALAFGRA 416
120405899 393 INNSFGFGGHNVSLVFGRP 411
111018213 398 INNSFGFGGHNVALAFGRA 416
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap