Conserved Protein Domain Family
PRK07856

?
PRK07856: PRK07856 
short chain dehydrogenase; Provisional
Statistics
?
PSSM-Id: 236116
View PSSM: PRK07856
Aligned: 50 rows
Threshold Bit Score: 317.261
Threshold Setting Gi: 256397849
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
304309821   1 MYDFSNKTVIVTGGTKGVGLGVTRAFLKAGATVYICGRRAPeetieVDGNVARFIAADVRKPEETQAIVDQAVRETGHLD 80 
271963598   4 SYDYAGSVVLVTGGTKGLGAGIAGAFLAAGAQVVVCARKEPs----ALPAGVGFVAADVRDPAEVDRMIGEIEERHGRLD 79 
269127682   8 AVDFTGRAVLVTGGTKGIGAVIAKAFLQAGAEVTVCARNEPpeppsAAGRKAHFLAADIRDAAQAAAMVERAAELMGRLD 87 
226365302   6 PLDFSDRSVVVTGGTKGIGFVVAEAFLAAGANVLVCGRSEPdrlpaHGDRTAAFRATDVRDHADAAALIDEAVTRFGRLD 85 
146275974   6 HIDLVGQVAIVTGGTRGLGRQIAEALVRAGAAVTVCGRTEPddl----peGLHFHAADIREPDQATALVDAVVARYGRID 81 
182434623   7 PMDLTGRAVLVTGGTRGLGAAIARAFLACGADVMVCGRTTPttlpsTDGREAAFRAADLRDPVAAADVVAATAERFGRLD 86 
111022794   6 PLDFSGRTVVVTGGTKGIGFVVAESFLAAGANVLVCGRSAPdtlpaHGERTAVFRATDVRDHADAAALIDDAVARFGRLD 85 
148556525  26 GVADKGRTALITGGGKGLGRAISEALLAEGWTVATCGRSEPetlpeAGGRTAFFEPCDVRKPDEIAALVDRVVARTGRID 105
145595158   3 PLDFTGRGVVVTGGTRGVGAAIASAFLAAGARVLVCGRTQ------PSSVVPDFVQADVRDPGQAAALVAAAIDRFGRLD 76 
159038403   3 PLDFTDRVVVVTGGTRGIGAAIASAFLAVGARVLVCGRNQ------PSTVVPDFVQADVREPTQAAALVAAAAERFGRID 76 
304309821  81 VLINNAGGSPPVNAADAPVKLTEAIIRLNLIGPMIFAQQAHAAMRNNVGgGVIVNIASVSGVRPSPGTAAYGAAKAGLIN 160
271963598  80 TVVNNAGGSPYAPLAGTSPRLHARIVELNLTAPLLVAQRAHPLLDA--AgGSVVMIGSSSGTRPSPGTSAYGAAKAGLHH 157
269127682  88 VVVNNAGGSPDAEAATVSPRFVERIVQLNLLAPFYVAQPANKIMQSQEDgGCIINIGSVSGIDPQPGTAAYSAAKAGLRT 167
226365302  86 VLVNNAGGSPDADAATVSPRFVEKIVALNLLAPFTVAQAANAVMQGQSDgGAIVNIGSVSAHDPQPGTAAYSAAKAGLLV 165
146275974  82 ILVNNAGGSPQAPAT-ASPRFFDAIVRLNLHAAMYMSQAAFAHMQP-ARrGSIVNIASVSGIRPSPMTAAYGAAKAGLLN 159
182434623  87 TLVNNAGGSPDADAATVSPRFVEKVVALNLLAPFYAAQAANLVMREQPGgGGVINIGSVSAHDPQPGTAAYSAAKAGLLG 166
111022794  86 VLVNNAGGSPDADAATVSPRFVEKIVALNLLAPFTVAQAANAVMQQQSDgGAIVNIGSVSAHDPQPGTAAYSAAKAGLLV 165
148556525 106 LLVNNAGGSPPVPAAEASPRFSEAIVALNLLGPLHMARACHPVMARQPEgGVIVNIASISGTRPSPGTAAYAAAKAGLLN 185
145595158  77 VLVNNAGGGPPVAAASASPRLHAKIVELNLVAPLHVAQAANTIMQQQPGgGAIVMVGSVSGTRPSPGSAAYGAAKAGLHH 156
159038403  77 VLVNNAGGAPSTVAATASPRLHAKIIELNLVAPLHVAQAANTVMQQQTGgGVIIMVGSVSGTRPSPGSAAYGAAKAGLHH 156
304309821 161 VSRSLAQEWGVDrVRVNAIIAGLIRTEAAED-HYGGQAGIALIEESLPMRRMAVPEDIANACLFLAADSSQYISGAALEV 239
271963598 158 LAACLAAEWAPR-VRVNTVVVGLAETESAAG-HYGGPEGVRRMGATIPAGRMALPGDVAGACLWLAAP--GYVTGAEILL 233
269127682 168 FTQALALEWAPK-VRVNHITVGLVLTEAAAS-YYGDGSAFNKI---IPMGRMGTPQDVADTCLYLASDLARYVTGADLPV 242
226365302 166 LTKALALEWAPK-VRINHITTGLIRTESAAA-VYGEDGG-AAVTRTLPMGRMAVPSDIADACLFLASAQASYVNGADLAV 242
146275974 160 LTQSLAQEWGPDgVRVNAIIVGLMQTETAGE-TYGDDEAQAAVGRSLPLQRMGTGVDIAGAVLWLCSGLASWVSGARINV 238
182434623 167 LTRALALEWAPR-VRVNHITAGPVRTENSGT-PYGD-DGLAALADLVPMGRPAEPDDVARACLWLACDLSSYVNGADLAV 243
111022794 166 LTKALALEWAPK-VRINHITTGLIRTESAAS-VYGDDGG-AAVTRTLPMGRMAVPSDIADACLFLASAQASYVNGADLAV 242
148556525 186 LTDSLAMEWGPT-IRVNALIVGLLDTGAADAdHYGGAEGIARINASLPMKRMAKGSDVAATVIFLASPAAAYLSGARIAI 264
145595158 157 LATSLAAEWAPA-VRVNSVVPGPVVGDAGLQ------LDPAAVARTVPLGRPATPAEVAGVCLLLASPLASYVTGAAVAV 229
159038403 157 LATSLAAEWAPA-VRVNSVVPGPVAGDADLR------LDPAAVARTVPLGRPATPAEVAGVCLLLASPMASYVTGAAVAV 229
304309821 240 YGAGEPPSFLKLAEqaaalaQK 261
271963598 234 HGGGEIPAWREIAS------GH 249
269127682 243 HGGGEYPARWLITH------R- 257
226365302 243 HGGGEYPARYLATH------S- 257
146275974 239 DGGGERPYFLDLVK------GN 254
182434623 244 HGGGEIPARYRATH------RP 259
111022794 243 HGGGEYPARYLATH------S- 257
148556525 265 HGGGERPVFLDLAS------AS 280
145595158 230 HGGGEWPGYLADVR------AQ 245
159038403 230 HGGGEWPGYLADLR------GD 245
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap