Conserved Protein Domain Family
PRK07855

?
PRK07855: PRK07855 
lipid-transfer protein; Provisional
Statistics
?
PSSM-Id: 181147
View PSSM: PRK07855
Aligned: 56 rows
Threshold Bit Score: 576.93
Threshold Setting Gi: 148554751
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118467263   1 MLSRKAAIVGIGATDFSKDSGRSELRLAAEAVLDALDDAGLSPADVDGLTTFTMDTNNETAVARAVGIGDLKFFSQIGYG 80 
226303887   4 GFSRQAAIAGIGATEFSKNSGRSEWQLACESVIAALDDAHIEAEEVNGFALFTMENNPEIAVARALGIPELTFFSRIPHG 83 
290959587  17 VLKDATAIVGIGQTAFARQLPETERTLACRAILAALDDAGIAPDEVDALASYTMEETDEVEVAKALGLGDLTFFSKVGYG 96 
269127685   3 VLPGAAAIAGIGATEFSKNSGRSELQLACEAVLAAIADAGLEPSDVDGLVTFTADTSSEIHVARNTGIGELKFFSRVGYG 82 
304309819  21 NLSNKSAIVGVGTTEFSKNSGRSELSLACEAVIDALRDSGLKPSDVDGMVTYTMDTNDEIEIGRAIGCNDLSFYSRVPHG 100
29830350    3 GLKDATAIVGIGQTPFAKHLPEDERTLACRAVLAALDDAGIAPGEVDALASYTMEETDEVQLAKAVGFGDLTFFSKVGYG 82 
182436808   3 TLKDATAIAGIGQTAFAKRLPESEKTLACRAILAALDDAGIAPSEVDGFASYTMEETDEVEVAKAIGAGDVTFFSKVGYG 82 
111022792   4 PLSGAAAIVGIGATEFSKHSGRSELQLACEAIVAALADAGIDPSEVDGLSTYTAETNGEVLVTRNTGIGELKFFSRIGYG 83 
148554931   4 SFVSRAAIAGYGATEFSKCSGRSELQLAMEAILAALADAGVDPAEVDGFATYTMDNNSEHEIFRLLGAREMRFFARTTGG 83 
256397853   5 PLKDRAAIVGIGQTEFAKHLEPSEKALACRAIAMALDDAGIAAHEVDAFAAYTMEATDEVEIAKAVGAGDVTFFSRVGFG 84 
118467263  81 GGAACATVQQAAIAVATGVADVVVAYRAFNERSGMRFGQVQTRLAGDaraqADSTAADNSFSYPHGLSTPAAQVAMIARR 160
226303887  84 GGGACAPVQQAALAVASGVADVVVVYRAFNERSGHRFGAGPPPFAYN----ASTDQEYRNWINPYGLLTPAQQEAFLAKL 159
290959587  97 GGGSCATVAHLAAAIATGQATVGVAWRSRKRGSGPRPWKNT----------TVQLPTPAQWTRPYGLLRPADEIAMLARR 166
269127685  83 GGAACGTVQQAAMAVATGIAEVVVCYRAFNERSGVRYGLGQAGRQMD----QGADSAAYAWLLPFGLNTPAQWVAMFARR 158
304309819 101 GGAPTGCIEQAAMAIATGVAEVVVCYRALNGRSGHRYSAGVSGNI------VTGDMIHYGWYLPYGLLTPASWVAMYHQR 174
29830350   83 GGGSCATVAHLAAAIATGQATVGVAWRSRKRGSGPRPWKNT----------SAQLPTPAQWTRPFGLLRPADEIGMLTRR 152
182436808  83 GGGSCATLAHLAAAVATGQASVGVAWRSRKRGSGPRPWKNT----------AVQLPTPAQWTRPYGLLRPADEIGMLARR 152
111022792  84 GGAACATVQQAAMAVATGIADVVVCYRAFNERSGVRYGLGQHDRPMD----STADRAAYAWLTPQGLSTPAQWVAMFARR 159
148554931  84 GGAACGPLQQAMLAVSAGMADTVVCYRAMNERSEYRFGVPMAPTA------PTSANLLFGFLGAQGLRTPAALIAMTMRR 157
256397853  85 GGGSCATVGHLAMAIATGQASVGVAWRSRKRGSGPRPWTDT----------VNQLATPAQWTRPFGLLRPVDEIAILARR 154
118467263 161 YMHLSGATSRDFGAISVADRKHAAKNPKAYFYEKPITIEDHQNSRWIAEPLRLLDCCQETDGAVAIVVTSVERARDLKQR 240
226303887 160 YMHKYGATSADFGQISVLSRKHAANNPKAWFYERPITIEDHQNSRMIADPIRLLDCCQESDGGQALVIVSAERARDLPHK 239
290959587 167 HMHEYGTTRDHLFNVALACRNRANQNPAAIMYERPLTREMYMNSRWISEPLCLFDNCLETDGALACVVVSAERARDCRRT 246
269127685 159 YMHEYGATSEDFGRVAVVDRKHAATNPKAWFYQRPITLEDHQNSRWIVEPLHLLDCCQESDGGQALVVVSTERARDLPHP 238
304309819 175 YEHLFGNTKDALAEIAIATREYAVTNPRAFFHKRPLTREEYNKGKPIALPFNLYDCCQESDGGCAVVVTTPERAKHLNHL 254
29830350  153 YMHEYGATRDHLFNVALACRNRANQNPAAIMYDRPLTREMYMTSRWISEPLCLFDNCLETDGALACVVVSAARARDCPQR 232
182436808 153 YLHEYGATRDHLFNVALACRNRANQNPAAIMYDHPLTREMYMTSRWISEPLCLFDNCLETDGALACVIVSAERARDCRHK 232
111022792 160 YMHRYGATSEDFGRVAVVARKHAADNPAAWFHGRPITLDDHQKSRWIAEPLHLLDCCQETDGGQALVVVSAQRAKDLRAT 239
148554931 158 YMHETGATEEDFATVAVTTRKHAAANPNAFFHGKPITREDYFAAPMIADPLRLLDCCQETDGAVAIVVTSVERAAALGHR 237
256397853 155 YMHEYGLTREQLGAVAIACRNRANANPAAIMYDRPLTLDDYLSARMISDPLCLFDNCLETDGALAVVMVSAERARDCRQA 234
118467263 241 PAVIEAAAQGSSPDQYTMVSYYRSEL-GLPEMG-VVGRQLWQQSGLKPTDIQTAVLYDHFTPFTLIQLEELGFCGKGEAK 318
226303887 240 PAIISGAAQGVGPQQISMSSYYREDIdSMPEVE-LVARQLWDQAGIGPDDIDAAILYDAFTPMVLLQLEEYGFCGRGEAK 318
290959587 247 PVYVHSAAQGLPAQHHGMVNYWNDDPlTGPAW--TAARHLWKHADITPDDIDVAQIYDAFTALIPLSLEGYGFCGRGEGG 324
269127685 239 PALIWGAAQGSGYDQHMMTSYYRSEItGIPEMG-LVGQQLYAQSGLNPSDIGAAILYDHFTPLVLPQLEELGFCARGEAK 317
304309819 255 PVMVKGVGMCAERNTEAMTNFYADEIaAIRSMD-LAAKQAYAQSGLTPEDIDAAIIYDAFTAIVMWQLESWGFADTGKAA 333
29830350  233 PAYIHSAAQGLPAQHHGMVNYWNDDPlTGPAW--TAARHLWKHADLSPQDVDVAQIYDAFTPLIPLSLEGYGFCGRGEGG 310
182436808 233 PVYLHSVAQGLPAQHHGMVNYWNDDPlTGPAW--TAARQLWKQADFGPEDVDVAQIYDAFTPLVPLSLEGYGFCGRGEGG 310
111022792 240 PAIVKAAAQGSGKDQHMMASYYRPDItGIPEMG-LVGRQLYGQSGLAPDDISAAILYDHFTPLVLPQLEELGFCGPGEAK 318
148554931 238 PIRIKAAAQGLPKGSFGLGSYWREDI--VPREGsIVARGLYAQAGLGPKDIDVAILYDHFAPTVLPSLEAYGFCAPGEAK 315
256397853 235 PVYVHAFGQGLPAQHHGMVNYWNDDPlAGPSW--IAAKQLWKHSDLGPADVDVAQIYDAFTPLIPLSLEGYGFCGKGEGG 312
118467263 319 DFIADGAIEIGGRLPINTHGGQLGEAYIHGMNGIAEGVRQLRGTSVNP-VPDVEHVLVTAGTGVPTSGLILG 389
226303887 319 DFIADGNLELDGRLPINTHGGQLGEGYIHGVNGIAEGVRLIRGTSTNQpTKTLDNVLVTGGSPVPHSALVLS 390
290959587 325 AFTEGGALESGGRLPLNTSGGGLSEAYVHGFNLINEGVRQLRGTSTAQ-VPGAAACLVTAGEGVPTSALLLR 395
269127685 318 DFIADGNLEIGGRLPCNTHGGQLGEAYIHGMNGIAEAVRLVRGTSVNQ-PGDVTNVLVTAGTGVPTSGLILG 388
304309819 334 EFVLSGALRKDGRLPTNTHGGQLSEAYIHGMNGVNEGVRLVRGTSNNQpAKVINNVLVTSGVGVPTGGMLLG 405
29830350  311 AFTEGGALEIGGRLPLNTGGGGLSEAYVHGFNLINEGVRQLRGTSTAQ-VPGAATCLVTAGEGVPTSALLLR 381
182436808 311 AFTEGGALEIGGRLPVNTGGGGLSEAYVHGFNLITEGVKQLRGTSTAQ-VPDAATCLVTAGEGVPTSAVLLR 381
111022792 319 DFIRDGNLEVGGRLPANTHGGQIGEAYLHGVNGIAEAVRLIRGTSTTQ-PDGIGNVLVTAGTAVPTSGLILG 389
148554931 316 EFIKDGNIEIGGGLPVNPHGGLLAEAYIHGLNGVGEAVRQLRGTSVNQ-RPGAANILVTGASAVPTSGVILG 386
256397853 313 AFADDGGLELAGRLPINTSGGGLSEAYVHGFNLINEGVRQLRGTSTNQ-VDGASTCLVTAGEAVPTSAVLLR 383
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap