Conserved Protein Domain Family
PRK07851

?
PRK07851: PRK07851 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 181146
View PSSM: PRK07851
Aligned: 58 rows
Threshold Bit Score: 675.566
Threshold Setting Gi: 284043806
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
302865417   6 PRDAVIVATARSPIGRAFKGSLREVRPDDLAATIVQAALDKVPALDPTTIDDLYLGCGLPGGEQGFNMARVVATLMGLDG 85 
86743126    1 MTEAVVVAATRSPIGRAFKGSLRGMRADDLAAIIVRAALDQVPALNPADIDDLILGCGLPGGEQGHNISRVVAVSLGFDT 80 
111226107   1 MTEAVVVAAARSPIGRAFKGTLRGLRADDLAATIILAALDQVPMLDPFEIDDLIVGCGLPGGEQGHNIGRVVAVSLGLDR 80 
284989508   1 MPEAVIVATARSPIGRAFKGSLKDLRPDDLTATIVRAALDKVPALDPTDIDDLILGCGLPGGEQGHNMGRVVSVLLGMDH 80 
21221520    1 MPEAVIVSAARSPIGRAFKGSLKDLRADDLAATIIQAALAKVPELDPRDIDDLMLGCGLPGGEQGNNLGRIVAVEMGMDH 80 
290959847   2 MPEAVIVSAARSPIGRAFKGSLKDLRPDDLTATIVAAALAKVPELDPKDIDDLMLGCGLPGGEQGHNLGRIVAVQLGMDH 81 
145593466   6 SRDAVIVATARSPIGRAHKGSLREVRPDDLTATIVQAALDKIPQLDRSEIDDLYLGCGLPGGEQGFNLARVVATLMGHDD 85 
159036507   6 SRDAVIVATARSPIGRAHKGSLREVRPDDLAATIVQAALDKIPQLDRTDIDDLYLGCGLPGGEQGFNLARVVATLMGLDG 85 
284043806   2 SEHAVIVATARTPIGRAGKGSLTELRADDLAAIAVRAALERVPQVRPEHVEDLLLGCGQPAGEQGYNMARVVALLSGLPA 81 
291298482   1 MTEAVIVATARTPIGRAVKGSLKDLRPDDLAATAVRAALDKVPDLDPAIIDDLYLGCGLPGGEAGFNMGRVVSVLLGYDH 80 
302865417  86 LPGATLTRYCASSLQTTRMAMHAIRAGEGDVFISAGVEMVSRYARGNSDTLPpEAqalvgggwENPRFAEARERSAARAQ 165
86743126   81 VPGTTVSRYCASSLQALRMAAHAVRAGEGDAFIAAGVEVVSGFVRGNSDSLP-DT--------QNPRYCEAQARTAARAQ 151
111226107  81 VPGTTVSRYCASSLQAIRMALHAVRAGEGDVFVAAGVEVVSGFVKGNSDSLP-DT--------QNPSYAGAQARTAARAG 151
284989508  81 LPGATITRYCSSSLQTTRMAMHAIKAGEGDVFLSAGVEMVSRFVKGNSDSLP-DT--------QNPAFANAQARVAKTAE 151
21221520   81 LPGCTVTRYCSSSLQTSRMALHAIKAGEGDVFISAGVEMVSRFAKGNSDSLP-DT--------RNPLFAEAEARTAEVAQ 151
290959847  82 LPGCTVTRYCSSSLQTSRMALHAIKAGEGDVFISAGVEVVSSTARGTSD-IP-TA--------RNPLFAEAEARTEAVSK 151
145593466  86 LPGATLTRYCASSLQTTRMAMHAIRAGEGDIFVSAGVETVSRYARGTSDGLPpEAqalvgggwENPRFSAAQERSTARAK 165
159036507  86 LPGATLTRYCASSLQTTRMAMHAIRAGEGDAFVSAGVETVSRYARGTSDGLPpEAqalvgggwENPRFAAARERSVARAQ 165
284043806  82 VPGVTVNRYCASSLQAIRMAAHAIAAGEGDCFVAAGAEAVSRYGRGKADGMP-ET--------KNPAFDGARARTAARAQ 152
291298482  81 LPAATLTRYCASSLQTTRMAAHAIKAGEGDVFISAGVEAVSRYGRGNSDGLPePVqaqvgggwQNPVFDAARERSAHRAE 160
302865417 166 GGSEvWTDPREAGQLPDIYLAMGQTAENLAQAYDVTREDMDAFGVRSQNLAEKAIADGFWAREITPVTTPDGTVVSTDDG 245
86743126  152 AGSApWTNPRAAGELPDVYIAMGQTAENVAQLAGVSRLEQDEYACRSQNLTERAVADGFFKREIIPVPLPDGGVIDSDDS 231
111226107 152 AGSPpWTDPRRTGELPDVYMAMGQTAENVARLTGVGRAEQDEFACRSQNLAVQAIAAGFYKRELTPVRLPDGTVVDADDG 231
284989508 152 SGADsWTDPRDNGEVPDIYVAMGQTAENLALFKDVSREEMDEFAVRSQNLAEQATADGFWEREITPVTTPDGTVVTKDDS 231
21221520  152 QEGTtWHDPREDGLVPDPYIAMGQTAENLARAKGITRQDMDEFGVRSQNLAEEAIKNGFWEREITPVTLPDGTVVSKDDG 231
290959847 152 SVGAsWHDPREDGLLPDPYIAMGQTAENLARQWGVTRADMDEFGVRSQNLAEEAIGKGFWEREITPVTLPDGTVVSKDDG 231
145593466 166 GGAEvWTDPRDSGDLPDIYLAMGQTAENLAQVHGVTRAEMDEFGVRSQNRAEQAIADGFWAREITPVTTPDGTVVSSDDG 245
159036507 166 GGAEvWTDPRVSGELPDIYLAMGQTAENLAQVYDVTRADMDEFGVRSQNRAEKAIADGFWAREITPVTTPDGTVVRADDG 245
284043806 153 GGASaWAPAEG---LPDVYIAMGETAENVAEHAGVTRAAMDEWAARSQQRAVAAQAAGLFAREIVPVTTPAGVVVEADDG 229
291298482 161 NGAVgWDDPRESGEVPDIYLAMGQTAENLALARGVTRAEMDAFGVRSQNLAEKAIADGFWAEEITPVTLPDGTVVATDDG 240
302865417 246 PRAGVTLEAVAGLKPVFRPDGRITAGNCCPLNDGAAAVVIMSAQRASELGLTPLARIVSTGVTALSPEIMGLGPVEASKQ 325
86743126  232 PRPGTTMRALAALRPVFRPDGTVTAGNACPLNDGAAAVIVMSDTRARELGITPLARIVSTGVSALSPEIMGLAPVEASRR 311
111226107 232 PRPGTTIEALAALPPVFRPDGTVTAGNACPLNDGAAAVVVMSDTRARELGITPLARLVSTGVSALSPEIMGLAPVEASRQ 311
284989508 232 PRAGTTLEGISGLKPVFRPDGRVTAGNACPLNDGAAAVVVMSDTKARDLGLTPLARIVSTAVTGLSPEIMGYGPVDASKL 311
21221520  232 PRAGVTLEGVQGLKPVFRPDGLVTAGNCCPLNDGAAALVIMSDTKARELGLTPLARIVSTGVSGLSPEIMGLGPVEASKQ 311
290959847 232 PRAGVTLEAVQGLKPVFREDGLVTAGNCCPLNDGAAALVIMSDTKARELGLTPLARIVSTGVSGLSPEIMGYGPVEASKQ 311
145593466 246 PRPGVTLSAVSQLNPVFRPDGRITAGNCCPLNDGAAAVVVMSAQRASELGVTPLARIVSTGVTALSPEIMGLGPVEASKQ 325
159036507 246 PRPGVTMAAVSQLDPVFRPDGRITAGNCCPLNDGAAAVVVMSAQRASDLGITPLARIVSTGVTALSPEIMGLGPVEASKQ 325
284043806 230 PRAGTTAAKLSALRPVFRPDGRITAGNACPLNDGAAAVVVTSASFARRHGIVPLARVLATAVSAVDPEIMGLGPVDACGR 309
291298482 241 PRAGVTLEAVSGLKPVFRPDGRVTAGNCCPLNDGAAAVIVMSDTKAAELGITPLARIVSTGVTAMSPEIMGIGPVEASWQ 320
302865417 326 ALKRAGMTIDDVDLVEINEAFAAQVIPSYRQLGIPEEKLNVAGGAIAVGHPFGMTGARITGTLLNALEWHDKTIGLETMC 405
86743126  312 ALARAGMTIDDVDLVELNEAFAAQVIPTYRALGLDVAKLNVHGGAIALGHPFGMTGARLLTTLLNGLRTTDTTIGLETMC 391
111226107 312 ALARAGMTIDDVDLVELNEAFAAQVIPTYRELGVDLAKLNVHGGAIALGHPFGMTGARILTTLINGLRTTDGTIGLETMC 391
284989508 312 ALQRAGMSIGDIDLVEINEAFAAQVIPSYRDLGIDIDKLNVHGGAIAVGHPFGMTGARITGTLINGLQTRDATFGLETMC 391
21221520  312 ALSRAGLGVGDIDLVEINEAFAAQVIPSYRDLGIPLEKLNVNGGAIAVGHPFGMTGARITGTLINSLRTHDKQFGLETMC 391
290959847 312 ALFRAGLSVGDIDLFEINEAFAAQVIPSYRDLDIPLDKLNVNGGAIAVGHPFGMTGARITGTLINSLQFHDKQFGLETMC 391
145593466 326 ALKRAGMTIDDVDLVEINEAFAAQVIPSYRQLGIAEEKLNVMGGAIAVGHPFGMTGARITGTLLNALQWNDATIGLETMC 405
159036507 326 ALRRAGMTMDDVDLVEINEAFAAQVIPSYRQLGIPEEKLNVMGGAIAVGHPFGMTGARITGTLLNALQWHDGTIGLETMC 405
284043806 310 ALERAGMTIGDVDRAEINEAFAAQVLPSAEQLGLDLDRLNVRGGAIALGHPFGMTGARIMTTLLHTLQDDDATIGLESMC 389
291298482 321 ALARAGLGIDDMDLVEINEAFAAQVIPSYQDLGVPLEKLNVHGGAIAVGHPFGMTGARITGTLLHGLQRTGGRYGLETMC 400
302865417 406 VGGGQGMAMVLERLS 420
86743126  392 VGGGQGMALVVERLS 406
111226107 392 IGGGQGMALVLERLS 406
284989508 392 VGGGMGMAMVLERLS 406
21221520  392 VGGGQGMAMVIERLS 406
290959847 392 VGGGQGMAMVIERLS 406
145593466 406 VGGGQGMAMVIERLN 420
159036507 406 VGGGQGMAMVIERLS 420
284043806 390 IGGGQGMAVVVERLS 404
291298482 401 VGGGQGMAMVIERL- 414
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap