Conserved Protein Domain Family
PRK07850

?
PRK07850: PRK07850 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 181145
View PSSM: PRK07850
Aligned: 36 rows
Threshold Bit Score: 636.764
Threshold Setting Gi: 145595323
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
31794722    1 MGYPVIVEATRSPIGKRNGWLSGLHATELLGAVQKAVVDKAGIQsglhAGDVEQVIGGCVTQFGEQSNNISRVAWLTAGL 80 
226308590   1 MGHAVIVEAARTPIGRRRGALAGLHPAEILGAAQLGVLERAGVA----PEDIGQIIGGCVTQAGEQSNNVTRQAWLHAGL 76 
119716965   1 MGTPVIVDAVRTPLGKRKGWLAGVHPAVLLGFAQRQVLARAGID----SELVEQVVGGCVTQAGEQSNDMVRRAWLHAGL 76 
290960892   2 AAEPVIVEAVRTPIGRRGGALANLHPAYLLGETYRELLGRTGIP----ADCVEQIVGGTVTHAGEQSMNPARTAWLTMGL 77 
269127701   1 MPEAVIVEAVRTPVGKRNGVLSGLHPAELLGAAQKGLLDKAGIA----PEVIGQVVGGCVTQAGEQSNNVTRQAWLHAGL 76 
29832385    2 AAEPVIVEAVRTPIGKRGGALAHLHPAYLLGETYRELLGRTGIH----ADCVEQIVGGTVTHAGEQSMNPARTAWLTMGL 77 
226365286   1 MGNAVIVDAARTPIGRRRGALSGLHPVELLGAVQRGVVERAGLA----AEDVGQIVGGCVTQAGEQSNNVTRQAWLHAGL 76 
182438963   2 AAEPVIVEAVRTPIGRRGGALANLHPAYLLGETYRELLGRTGIQ----ADCVEQIVGGTVTHAGEQSMNPARNAWLTVGL 77 
111022778   1 MGNAVIVDAARTPIGRRRGALSGLHPAELLGAAQRGVLERAGVA----PADIGQIVGGCVTQAGEQSNNVTRQAWLHAGL 76 
145595323   1 MSEAVIVAAARTPIGRRNGWLSGLKAVELLRTVQREVLDRAGLP----PSEVDQIIGGCVTQVGEQSLNITRNAWLSTGL 76 
31794722   81 PEHVGATTVDCQCGSGQQANHLIAGLIAAGAIDVGIACGIEAMSRVGLGANAGPDRSLIRAQSWDIDLP--NQFEAAERI 158
226308590  77 PYSTAATTVDCACGSAQQAVHLISGLISSGQISAGIGCGVEAMSRVFLGQANAPGTGNPYPDAWTIDMG--DQFTSAQRI 154
119716965  77 AQHTGATAIDAQCGSGQQSAHLVHDMVAAGTIEVGVACGVEAMSRIPLGANVPPGLGDPRPDDWTIDMP--NQFEAADRI 154
290960892  78 PYETAATTVDCQCGSSQQASHMVANMVAAGVIDVGISCGVEAMSRVPLGSGSKHGPGKPFPEEWNVDLP--NQFEAAERI 155
269127701  77 PYQTACTTIDCACGSSQQAVHMVAGLIASGAIDAGIGCGVESMSRVFLGQAVTPETGNPFPDSWSLDMP--DQFTAAERI 154
29832385   78 PYETAATTVDCQCGSSQQASHMVANMVAAGVIDVGISCGVEAMSRVPLGSGSKHGPGKPFPDEWNVDLP--NQFEAAERI 155
226365286  77 PYTTAATSIDCACGSSQQAVHVVAGLIASGQISAGIGCGVEAMSRVFLGQAATPETGNPYPGDWSIDMG--DQFTSAQRI 154
182438963  78 PYETAATTVDCQCGSSQQASHMVANMVAAGVIDVGISCGVEAMSRVPLGSGSKHGPGKPWPDEWNVDLP--NQFEAAERI 155
111022778  77 PYTTAATSLDCACGSSQQAVHVVAGLIASGQISAGIGCGVEAMSRVFLGQAVTPETGNPYPDDWSIDMG--DQFTSAQRI 154
145595323  77 DPQVACSTVDTSCGSAQQANHLVAALITAGVIDVGIACGVESMSRVPVGTNLYQGPGHYKTDDYPWDDPprAQFGGAERI 156
31794722  159 AKRRGITREDVDVFGLESQRRAQRAWAEGRFDREISPI-QAPVLDEQNQP-TGERRLVFRDQGLRETTMAGLGELKPVLE 236
226308590 155 AEKRGITRADVDAFGLESQRRAAQAWAEGRFDREIVPV-KAPVVTKEGVP-TGEIATVTRDGGLRETTAEALAGLKPVIE 232
119716965 155 ARNRGITRADLDAFGLASQQKARVAVDEGRFKREIAPYdAAPVLDEGGSP-TGETRLVDTDQGLRDTTLEGLAGLRSVLP 233
290960892 156 ARHRGLTREDVDALGLLSQERAAAAWAEERFKKETFAV-QVPTTEAEQGAgQGMWRLVDHDEGLRDTSGEALARLKPIMP 234
269127701 155 AKRRGITRQDADAFGLASQRKAAQAWAENRFAGQIVEV-TAPVMGPEG-P-TGETAVVTRDQGLRETSMEALAKLKPVIP 231
29832385  156 ARNRGLTRENVDSLGLISQERAGAAWSEERFKRETFAV-QVPTTEEEQRAgQGMWRLVDRDEGLRDTSMEALAGLKPVMP 234
226365286 155 ADLRGLERGDVDALGLESQRRAAQAWAEGRFDREIVPV-TAPVVDRAGAP-TGESAVITRDGGLRETTAEALSALKPVID 232
182438963 156 ARKRGLTRERVDALGLLSQQRAAAAWAEERFKRETYAV-QVPTTEEEQAAgQGMWRLVDRDEGLRDTSMEALAGLKAVMP 234
111022778 155 ADLRGLGRGDVDAFGLESQRRAAQAWADGRFDCEIVPV-TAPVVDKSGTP-TGELAVVTRDGGLRETTAEALSALKPVID 232
145595323 157 AAKYGVDRAAADAYGVLSQRRAARAWAQGYFDQEIVAV-HAPDG-------EGGLRAVTRDQGLRDTTPEGLAGLRPTVD 228
31794722  237 GGIHTAGTSSQISDGAAAVLWMDEAVARAHGLTPRARIVAQALVGAEPYYHLDGPVQSTAKVLEKAGMKIGDIDIVEINE 316
226308590 233 GHIHTAGNSSQISDGAAAVLLMSEERAQELGLKPRARIVASGMVGSDPFYHLDGPIESTQMVLDKAGMTLNDIDLVEINE 312
119716965 234 DGLHTAGTSSQISDGASAVLIMDSDRARALGLTPRARIVTHCLVGSDPYYHLDGPIDATQRVLDRTGMSISDFDLFEVNE 313
290960892 235 TAVHTAGNSSQISDGAAAIMWASKRMARALKLRPRARIVAQALVGSDPHFHLDGPIDATRAVLGKAGMSLKDIDLVEINE 314
269127701 232 DGIHTAGNTSQISDGAAAVLLTTPEKAAELGLRPRARIVASGMVGSDPYYHLDGPIDATRHVLAKAKMTLDDIDLVEINE 311
29832385  235 TAVHTAGNSSQISDGAAAIMWASKRMARALKLRPRARIVAQALVGADPHFHLDGPIDATRAVLGKAGMSLKDIDLVEINE 314
226365286 233 GHIHTAGNSSQISDGAAAVLLMDEDRARALGLRPRARIVASGMVGSDPYYHLDGPIDSTRMVLDRAGMSLGDIDLVEINE 312
182438963 235 SAIHTAGNSSQISDGACAIMWSSKRMARALKLKPRARIVAQALVGSDPHFHLDGPIDATRAVLGKAGMSLRDIDLVEINE 314
111022778 233 GHIHTAGNSSQISDGAAAVLLMDGGRARELGLRPRARIVASGMVGSDPYFHLDGPIESTRMVLERAGMSLDDIDLVEINE 312
145595323 229 GGVHTAGTTSQVSDGAAAILWMSAERAAALGLRPQARLRHQVVTGSDPYLLLEGPVVATRKILDRSGLGLVDLDVVEVNE 308
31794722  317 AFASVVLSWARVHEPDMD---RVNVNGGAIALGHPVGCTGSRLITTALHELERTDQSLALITMCAGGALSTGTIIERI 391
226308590 313 AFASVVLSWAQVHDADLS---KVNVNGGAIALGHPVGSTGARLITTALHELERSNKSTALVTMCAGGALSTATIIERI 387
119716965 314 AFASVVLSWAGQHRVDLD---RVNVNGGAIALGHPVGSTGTRLITTALHELERRDASTALITMCAGGAMATGTVLERI 388
290960892 315 AFASVVLSWAQVFDQDLA---KVNVNGGAIALGHPVGATGARLITTALHELERTDKEFALVTMCAGGGLATGTIIQRL 389
269127701 312 AFASVVLSWAGVLNADMD---KVNVNGGAIALGHAVGSTGARLITQAVHELERADKSTALITMCAGGAHATATIIERI 386
29832385  315 AFASVVLSWAQVFEQDLG---KVNVNGGAIALGHPVGATGARLITTALHELERRDKEFALITMCAGGALATGTIIQRL 389
226365286 313 AFASVVLSWAQVHGADLS---KVNVNGGAIALGHPVGSTGARLITTALHELERSDTATALVTMCAGGALSTATIIERI 387
182438963 315 AFASVVLSWAQEFEADLDgleKVNVNGGAIALGHPVGATGARLITTALHELERRDKEFALITMCAGGALATGTIIQRL 392
111022778 313 AFASVVLSWAQVHGADMS---KVNVNGGAIALGHPVGSTGARLITTALHELERSDTSTALVTMCAGGALSTATIIERI 387
145595323 309 AFAAVVLAWMAANGTDAE---RVNVNGGAIALGHPLGASGTRLLVSALHELERTDRELALVTMCCGGALGTASILQRM 383
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap