Conserved Protein Domain Family
PRK07801

?
PRK07801: PRK07801 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 181123
View PSSM: PRK07801
Aligned: 45 rows
Threshold Bit Score: 719.567
Threshold Setting Gi: 297563089
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
121639475   1 MTEAYVIDAVRTAVGKRGGALAGIHPVDLGALAWRGLLDRTDIDPAAVDDVIAGCVDAIGGQAGNIARLSWLAAGYPEEV 80 
157961982   1 MANAYIVDALRSPTGRRKGGLSHIHAIDLAAHSLKALVERNAIPAADYDDVIFGCVDTIGSQAGNIARTSWLAAGLPLNV 80 
167624056   1 MPNAYIVDALRTPTGRRKGGLSHIHAIDLAAHSLKALVERNAIPAADYDDVIFGCVDTIGSQAGNIARTSWLAAGLPLNV 80 
264677419   2 SAQAYIVDALRSPTGKRKGSLATVHGADLGAHVIKALVERNDIPAADYDDVIFGCVDTIGSLAGDIARTSWLAAGMPLNV 81 
78062289    1 MRQAYIVDALRTPTGRRKGGLAHVHAADLGGFVLKTLVERNAIPADEYDDVVFGCVDTIGPLAGNIARTCWLAAGLPLQV 80 
206563478   1 MKQVYIVDALRTPTGRRKGGLAHVHAADLGGFVLKTLVERNAIPADEYDDVVFGCVDTIGPLAGNIARTCWLAAGLPLQV 80 
77359856    1 MTHAYIVDALRTPTGRRKGGLAHVHAIDLGAAVLKPLVERNNIPAEDYDDVIFGCVDTIGSQAGNIARTSWLAAGLAMNV 80 
188592337  11 MKDAYIVDALRTPTGRRKGGLSHVHGADLGGFVLAELVRRNGIPPEDYDDVVFGCVDTIGPLAGNIARSAWLAAGLPLTV 90 
116694613   1 MKDAYIVDALRTPTGRRKGGLSHMHGADLGGFVLAELVRRNGIPAEDYDDVVFGCVDTIGPLAGNIARSAWLAAGLPLTV 80 
73541255    3 MKHAYIVDALRTPTGRRKGGLSHMHGADLGGFVLAELVRRNDIPAEDYDDVVFGCVDTIGPLAGNIARSAWLAAGLPLTV 82 
121639475  81 PGVTVDRQCGSSQQAISFGAQAIMSGTADVIVAGGVQNMSQIPISSAMTVGEQFGFTSPTNESKQWLHRYGDQEISQFRG 160
157961982  81 PGTTVDRQCGSSQQAIHFAAQAVMSGTQDVIAVGGVQTMTQIPISSAMLAGQPLGFSTPFAESELWHKRFGDAPVDQFYA 160
167624056  81 PGTTVDRQCGSSQQAIHFAAQAVMSGTQDVIAVGGVQTMTQIPISSAMLAGQPLGFSTPFAESELWHKRFGDAPVDQFYA 160
264677419  82 PGTTIDRQCGSSQQAIHFAAQAVMSGTQDVVLAGGVQTMTAIPISSAMLAGQPLGFTTPFAESKGWQARFGNAPVNQFYA 161
78062289   81 PGVTVDRQCGSSQQAVHFAAQAVMSGVQDVVVAGGVQTMTQIPISSAMTCAAPLGFNDPFSGSTGWRARFGDAPVSQFVA 160
206563478  81 PGVTVDRQCGSSQQAVHFAAQAVMSGVQDVVVAGGVQTMTQIPISSAMTCAAPLGFTDPFSGSAGWRARFGDAPVSQFVA 160
77359856   81 PGTTVDRQCGSSQQAVHFAAQAIMSGTQDVIAVGGVQTMTQIPISSAMLAGQPLGFSTPFAESKLWHARFGDAPVNQFYA 160
188592337  91 PGVTVDRQCGSSQQAVHFAAQAVMSGTQDVVIAGGVQTMTQIPISSAMLAGQALGFADPFSGSKGWQARFGDAPVSQFHA 170
116694613  81 PGVTVDRQCGSSQQAVHFAAQAVMSGTQDVVIAGGVQTMTQIPISSAMLAGQALGFADPFSGSKGWQTRFGDAPVSQFHA 160
73541255   83 PGVTVDRQCGSSQQAVHFAAQAVMSGTQDVVIAGGVQTMTQIPISSAMLAGQALGFSDPFSGSKGWHARFGDAPVSQFHA 162
121639475 161 SELIAEKWNLSREEMERYSLTSHERAFAAIRAGHFENEIITVetesGPFRVDEGPR-ESSLEKMAGLQPLVEG-GRLTAA 238
157961982 161 AQRIADNWQISREMMESFSLESHNRALTAIKEGYFEREIVPL----AGVTQDETPR-VSSLEKMASLEPVGDAyPSITAA 235
167624056 161 AQRIADKWQLSRDMMESFSLESHNRALAAIKEGYFDREIVPL----AGVTQDETPR-VSSLEKMASLEPVGDAyPSITAA 235
264677419 162 AQRIADHWGVSRADMEVFAKESHDRALNAIAEGRFDREIVPF----GAFMMDETAR-LSTLEKMATLEPVDPDyPSITAA 236
78062289  161 AQRIADHWNLSRDAMERYALESHRRAVAAIEAGHFKREIVPL----EGVIHDETPRpDTSLEKMATLEPLTPG-GSLTAA 235
206563478 161 AQRIADHWNLSRDAMERYALESHRRAVAAIEAGHFKREIVPF----EGVMHDETPRpDTSLDKMATLEALTPG-GSLTAA 235
77359856  161 AQRIAEHWGISRADMEVFALESHRRALAAAAEGRFDREIVAI----EGLTFDETPR-ESSLAKMAELEPVDPTyPSITAA 235
188592337 171 AQRIAEHWKLSREAMEAYALESHQRAAAAIEGGRFAREIVPC----EGVTRDETPRpDTTLAKMAALEPLMPG-SALTAA 245
116694613 161 AQRIADHWKLSREAMEAYALASHQRAAAAIEGGRFAREIVPC----AGVKHDETPRpDTTLARMAALEPLMPG-SSLTAA 235
73541255  163 AQRIAEHWKLSREAMEAYALESHRRAAAAIEAGHFAREIVPC----EGVKHDETPRpDTTLPKMAALEPLMPG-SALTAA 237
121639475 239 MASQISDGASAVLLASERAVKDHGLRPRARIHHISARAADPVFMLTGPIPATRYALDKTGLAIDDIDTVEINEAFAPVVM 318
157961982 236 VSSQTCDASAAMLIVSEQALAKYQLKPRARIHHLSVLGDDPIWHLTAPIAATKAALQKAGMTLDDIDLVEINEAFASVAM 315
167624056 236 VSSQTCDASAAMLIVSEEALAKYQLKPRARIHHLSVLGDDPIWHLTAPIAATKAALQKAGMTLDDIDLVEINEAFASVAM 315
264677419 237 VSSSTCDAAAAVLVVSEAALKRYNLKPRARIHHMSVRADDPIWHLTAPIPATEYALKKAGMTMSDIDLVEINEAFASVVM 316
78062289  236 VASQTCDAAAALLIVSEDALKRYGLTPRARIHHLSVLGDDPLWMLTAPIPATKAALQKAGLDWSQIDVVEMNEAFASVAQ 315
206563478 236 VASQTCDAAAALLIVSEEALKRYDLTPRARIHHLSVLGDDPLWMLTAPIPATRAALKKSGLDLARIDVVELNEAFASVAQ 315
77359856  236 VSSSVCDASAAMLIVSERALKKYNLTPRARIHHVSVLGDDPIWHLRAPIPATIAALKKANLTLDDIDLVEINEAFASVVM 315
188592337 246 VSSQTADAAAALLIVSEDALKRYGLTPRARIAHMSVLGDDPLWMLTAPIPATKRALERSGLRMADIDVVEINEAFASVAM 325
116694613 236 VSSQTADAAAALLIVSEDALKRYQLKPRARIAHMSVLGDDPLWMLTAPIPATRRALERSGLRLADIDVVEINEAFASVAM 315
73541255  238 VSSQTADSAAALLIVSEDALKRYQLTPRARIAHMSVMGDDPLWMLTAPIPATKRALERSGLSLADIDVVEINEAFASVAM 317
121639475 319 AWLKEIKADPAKVNPNGGAIALGHPLGATGAKLFTTMLGELERIGGRYGLQTMCEGGGTANVTIIERL 386
157961982 316 AWLKETGYSHDKTNVNGGAIALGHPLGATGVRLMTGLLHELERRGGRFGLQTMCEGGGLANVTIIERL 383
167624056 316 AWLKETGYSHDKTNVNGGAIALGHPLGATGVRLMTGLLHELERRGGRFGLQTMCEGGGLANVTIIERL 383
264677419 317 AWLKETGYDHARTNVNGGAIALGHPLGASGAKLMTTLLHELERTGGRYGLQTMCEGGGQANVTIIERL 384
78062289  316 AWLADTRFPHEKTNPNGGGIALGHPLGATGARLMTTLLHELERTGGRYGLQTMCEGGGLANVTIIERL 383
206563478 316 AWLADTRFPHEKTNPNGGAIALGHPLGATGARLMTTLLHELERTGGRYGLQTMCEGGGLANVTIIERL 383
77359856  316 AWLKETGYSHEKTNVNGGAIALGHPLGATGVRLMTGLLHELERTGGRYGLQTMCEGGGLANVTIIERL 383
188592337 326 AWLAETGYAPERTNPNGGAIALGHPLGATGARLMTTLLHELERTGGRYGLQTMCEGGGLANVTIIERL 393
116694613 316 AWLAETGYAAERTNPNGGAIALGHPLGATGARLMTTLLHELERTRGRYGLQTMCEGGGLANVTIIERL 383
73541255  318 AWLAETGYSAARTNPNGGAIALGHPLGATGARLMTTLLHELERTGGRYGLQTMCEGGGLANVTIIERL 385
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap