Conserved Protein Domain Family
PRK07800

?
PRK07800: PRK07800 (this model, PSSM-Id:103060 is obsolete)
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 103060
View PSSM: PRK07800
Aligned: 38 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
119716031   3 GSVIVAGARTPIGRLLGGLKGLSAADLGGVAIKAALEKAGVTGDQVEYVIMGHVIQAGAGQITARQASVKGGIPMNVPAI 82 
117927880   1 MAVIVAGARTPIGRLLGSLAELSAVQLGGAAIRAALERGGAPPSEVDYVIMGQVLQAGAGQIPARQAAVAAGIPLTVPAL 80 
119960976   9 DVVILAASRTPQGRLNGQLAGFTAVDLGAHAITAALAASGVKAEQVDAVIMGQVLQAGAGQNPARQSAIAAGVGWNIPAV 88 
116671532   9 DVVILAAARTPQGRLNGQLAGFTAVELGAHAIKAALAASGVAAEQVDAVIMGQVLQAGAGQNPARQSAIGAGIGWNVPTV 88 
25027287   13 DIVILGARRTPQGKLLGQLSTLTATQLGGRAIAAALESAGVRPDQVDQVIMGQVVQSDAGQNPARQAAVEAGIGLDVPAV 92 
111225260   3 GSVIVAGARTPIGKLSGALKSFTATDLGGIAIKGALERAGLSGDAIQYVIMGHVIQAGTGPITARQAAVAAGIPMTVPAV 82 
86742368    3 GSVIVAGVRTPFGKLSGGLKSFTATDLGGIAISGALARAGLSGDAVDYVIMGHVIQAGAGQITARQAAVAAGIPLSVPAI 82 
158312898   3 GSVIVAGARTPIGKLSGALKDFTAVDLGGIAIRAALERAGLAGDAVDYVILGQVIQAGAGQAAARQAAVKGGIPMTVPST 82 
163840937   6 DVVILGGARTPLGKLQGALASFQAVDLGGFAIKGALEKANVKAEDVDAVIMGHVVQAGCGQNPARQSAIKAGIGWNRPTV 85 
21223759    9 TSVIVAGARTPMGRLLGSLKSFSGADLGSFAIKAALGRAGIGGDQVQYVIMGQVLQAGAGQIPARQAAVKAGIPMSVPAL 88 
119716031  83 TINKVCLSGMNAIALADQLIRAGEHEIVVAGGMESMTQAPHLLPKSREGFKYGDTALVDSMAYDALYDQFTDQPMGTLTE 162
117927880  81 TLNKVCLSGLNAIALAGQLADAGECDVIVAGGMESMTNAPHLLPGLRRGLRYGDGKLLDAMAVDGLVDAFDHLSMGESTE 160
119960976  89 TINKVCLSGLTAVIDAARMIRSGDATVVVAGGQESMTRAPHLLPGSRQGWTYGAIQALDVAAHDGLTDAFDGQSMGLSTE 168
116671532  89 TINKVCLSGLTAVIDAARMIRSGDAAVVVAGGQESMSRAPHILPGSRQGWTYGTVQALDVAAHDGLTDAFDGQSMGLSTE 168
25027287   93 TVNSVCLSGLRAITDAARLLRLGEAEVVVAGGQESMSGAPHLLPGARRGVAYGSVTAVDSLERDALTDAFDQRSMGVNTD 172
111225260  83 TVNKVCLSGLDAIALADTYIASGEFDLVVAGGMESMTGAPHLLRSMRAGVKYGATEALDAIDQDALFCAFDQISMGASTE 162
86742368   83 TINKVCLSGLDAIALADTYISSGEFDLVVAGGMESMTGGPHLLRSLRSGVKYGRAELLDATEHDALFCAFDQIAMGASTE 162
158312898  83 SINKVCLSGLNAISLADLYISSGQYDVIVAGGMESMTRAPHLLPALRGGVKYGDTTLTDSIAVDALTCGFDQVSMGLATD 162
163840937  86 TINKVCLSGLAAVTDAARLLRSGEASIVVAGGQESMTNAPHILPGSRSGWNYGNFTAIDSVAHDGLTDAFDGESMGASTE 165
21223759   89 TINKVCLSGLDAIALADQLIRAGEFDVIVAGGQESMTNAPHLLPKSREGYKYGAVQMIDAMAYDGLTDSFEDIAMGESTE 168
119716031 163 ACNTgARELTREEQDAFSARSHQLAAAAWKNGVFDDEVVPVEIPQRKGDPVVIANDEGIRGDTTAESLGKLRPAFSKDGT 242
117927880 161 RHNA-RYGITREAQDAFAARSHQLAAAARDSGRFDAEIVPVPVPSRRGESRIVQTDEGIRPETTPEILAKLPPAFTPDGT 239
119960976 169 TKNV-TLGIDRKAQDEVAAASHQRAAAAIADGTFDVEIAPVRVKQRKGDPLVLTTDEGVRPNTTVETLAPLKAAFATDGT 247
116671532 169 SKNL-VLGIDRTSQDNVAAQSHQRAALAAKNGVFDDEIAPISVKQRRGDPVVVATDEGVRPNTSVESLAGLRAAFVSDGT 247
25027287  173 EGNG-QFTISREQQDEVAALSHQRAAAAWEEGAFDAEITPVEVTVRKKGTITIDRDEGIRPETTVDSLAGLRPAFTPDGS 251
111225260 163 RYNG-ALNISRAEQDSFAARSHQRAAAAAKNGLFDNEIVPVSVPQRRGEPLVVSQDEGVRADTSAEVLGKLRPAFGKDGT 241
86742368  163 RYNA-GLGIGRAEQDEFGAQSHQRAAAATKNGLFDDEIVPVAVPQRRGEPLVVNQDESVRPDTTVEVLAKLRPAFDGNGT 241
158312898 163 RYNS-RYGITREEQDEFSARSHQRAAAAAKNGLFENEIVPVEVPQRRGDPIVVSADEGVRAETTAESLAKLRPAFDKAGS 241
163840937 166 RKNT-ELSLGRTEQDEVAAASHQRAAKAQESGIFDDEIVPVSLPQRKGDPLLVSQDEGVRANTTVETLSGLRAAFAKDGT 244
21223759  169 KHNT-RLGIERAAQDEIAALSHQRAAAAQKNGVFDAEITPVEIPQRKGDPVLFAKDEGIRGDTTAESLGKLRPAFAKDGT 247
119716031 243 ITAGSSSQISDGACAVVVMSKAKAEELGLTWLAEIGASGQVAGPDSSLQSQPANAIKKAVAKEGISVADLDLVELNEAFA 322
117927880 240 ITAGSSSQISDGACAVIVANRRVAEARGWPILAEIGAHGMVAGPDNSLHSQPARAIVRALNRDGLRVDDVALFEINEAFA 319
119960976 248 ITAGNSSPLSDGASALVLTSRRFAKDNGLDYLAVVGKPGQVAGPDNSLHSQPSNAIAQALKRAGWTAEDLDFIEINEAFG 327
116671532 248 ITAGNSSPLSDGAAALVLTTRKFAEDNGLDYLAVVGKPGQVAGPDNSLHSQPSNAIKSALDRAGWTTADLDFIEINEAFG 327
25027287  252 ITAGNSSPISDGAAATVLSTRAFAEAHGLEPLATIVGWANTAGPDTLLHAQPARATRAVLERAGWSTGDLDFLEINEAFG 331
111225260 242 ITAGSASQISDGAAAVIVASRAKAEELGLPILAEVGHHGFVAGPDTSLQSQPSNAILAALAKEGLTPADLDLVEINEAFA 321
86742368  242 ITAGSSSPISDGAAAVIVASRAKAEQLGLPILAEVGHHGFVAGPDTSLQSQPSRAILAALAKERLTPADLDLVEINEAFA 321
158312898 242 ITAGSASQISDGAAAVVVTSRAKAEELGLPIIAEVGHHGYVSGPDPSLHSQPSNAILAALAKEKLTPADLDLVEINEAFA 321
163840937 245 ITAGNSSPLSDGAAALVLTTRAKAEELGLKWIAVVGKPGQVAGPDTSLHSQPSNAIKQALGRAGWTAQDLDFIEINEAFG 324
21223759  248 ITAGSSSQISDGAAAVVVMSRAKAEELGLEWIAEIGAHGNVAGPDNSLQSQPSNAIRHALKKEGLEVADLDLVEINEAFA 327
119716031 323 AVGIVSARELGIPEEQVNVNGGAIALGHPVGMSGARIVLHLALELKRRGGGVGAAALCGGGGQGDALIVRVP 394
117927880 320 AVVLASMHELGVDEEKVNVNGGAIALGHPIGASGARLVLHLALELRRRGGGIGVAGLCGGGGQGDALVLRVF 391
119960976 328 SVAVQSLKDLRYPLEKCNIHGGAIALGHPIGASGARLALHAAHELKRRGTGKAAVSLCGGGGQGEALLLYRD 399
116671532 328 SVAVQSLKDLQYPLEKCNIHGGAIALGHPIGASGARLAGHAAHELKRRGSGKAAVSLCGGGGQGEALLLYRD 399
25027287  332 AVAVESLRELDYPLERTNIHGGAIALGHPVGTSGARIVVHAAHELARRGGGRAAVSICGGGGQGDALLLAR- 402
111225260 322 AVSIQSMRDLGISSDIVNVNGGAIAIGHPLGASGARIALTLLNELARRGGGIGAAGLCGGGGQGDALILRVP 393
86742368  322 AVAIQSMRDLGIGPEITNVNGGAIAIGHPVGASGARIALTLANELKRRGGGIGAAGLCGGGGQGDALVLRVP 393
158312898 322 AVGIQSMRELGIGPDITNVNGGAIAVGHPVGMSGTRVALTLLLELQRRGGGIGAAALCGGGGQGDALVLRVP 393
163840937 325 SVAVQSLKDLDYPLEKTNIHGGAIAVGHPIGASGARLALHAALELNRRGGGKAAVSLCGGGGQGEALLLYTD 396
21223759  328 AVAVQSMKDLGVSTEKVNVNGGAIALGHPIGMSGARLVLHLALELKRRGGGVGAAALCGGGGQGDALIVRVP 399
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap