Conserved Protein Domain Family
fabG

?
PRK07776: fabG (this model, PSSM-Id:103048 is obsolete)
3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Statistics
?
PSSM-Id: 103048
View PSSM: PRK07776
Aligned: 23 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
68535295    1 MSKYNYAGLTVIVTGGTRGIGHATALQLAASGANVVITGRKPETVGPAAEELQaaarkqnpdaGRVIGIAAHVADPEAAK 80 
57117021    1 MTSLDLTGRTAIITGASRGIGLAIAQQLAAAGAHVVLTARRQEAADEAAAQVG----------DRALGVGAHAVDEDAAR 70 
54025381    1 -MTGRFAGRTAIVTGASRGIGLAIAQRLVDDGAKVVITARKQDALDEAVRQLGg--------aEHALGVAGRADDLEHQE 71 
54025459    1 -MSSDLLGKSALVSGASRGIGKAVAAELLRRGANVLITARKPEPLAEAAAELRalg-----hqGEVATIAGNSGDAQARA 74 
119718083   1 --MQGLAGKVAIVTGASRGIGLGIAQRLVDEGAKVCVTARKQEALDAAVESLGg--------aEHAIAVAGKADDPAHRE 70 
111019717   1 -MNKRFEGKTAIVTGASRGIGLAIAERLVADGARVVITARKKEALDEAVTHLGg--------pDVALAVAGRADDADHQG 71 
134101894   1 -MSKRFDGRVAIVTGASRGIGLAIAERLVSEGAKVCLTARKPEPLEEAVRTLGg--------pEHAIAVAGKGDDAEHQA 71 
29833551    2 TALPELSGKVALITGASRGIGYGVAEALVARGDRVCITGRNEDALKEAVEALGa---------ERVIGVAGKAHDEAHQA 72 
29833801    2 TSPYGLEGRVAVVTGASRGIGRAVAEAFAAAGAHVCVTARDADGVRRAAEELG------------GVGLAGSVADPAHPR 69 
21219851    2 TELPEPSGKVALVTGASRGIGYGVAEALVARGDRVCITGRNEDALKEAVDRLGp---------DRVIGVAGKAHDEAHQA 72 
68535295   81 KACTQAVEEFGRLDVLINNAGTNPAFGPVHKQSAEIMTKVFQINTIGPVIWTSAAIEADLGKAarnggpAGAVVNVSSIG 160
57117021   71 RCVDLTLERFGSVDILINNAGTNPAYGPLLEQDHARFAKIFDVNLWAPLMWTSLVVTAWMGEH------GGAVVNTASIG 144
54025381   72 ETVARAIETFGGADLLVNNTGINPVYGALIDMDLAAARKIIEVNCLAALSWTQRAHKAWMAEH------GGAVVNVSSVA 145
54025459   75 EAVGRAVTEFGSLDILINNTGINPVFGALMDADLDAVRKIFDVNVVAALGYAQEAYKAWMGEH------GGAIVNVASVA 148
119718083  71 DAVRRTIETFGSLDLLVNNAGINPVLAHLVDIDLDAARKIVEVNALGALAWVQSAHRAWMAEH------GGAVVNISSVS 144
111019717  72 DAVRQAVETFGSIDFLVNNTGINPVYGSLVDLDLAAARKIVEVNCIAALSWVQQVHKAWMKEH------GGAIVNVSSLS 145
134101894  72 EAVARTVETFGRVDALVNNAGINPAYGPMIELDPGVARKTFEVNVLGALSWTQQVYGAWMREH------GGSVLNVSSVA 145
29833551   73 AAVERTMEAFGRVDYLVNNAGTNPVFGPIADLDLNVARKVFETNVVSALGFAQQTWKAWQGEN------GGAIVNIASVA 146
29833801   70 ELTELALAAFGRLDVVVNNAATNEPYGPLMDADPDRWREAFTINVEAPLRLVQCAWRAWMGEH------GGAVVNICTEG 143
21219851   73 VAVERVMEAFGRVDFLVNNAGTNPVFGPIADLDLNVARKVFETNVISALGFAQRTWHAWQKDN------GGAIVNIASVA 146
68535295  161 ALSMEDYIGVYNASKAALLHLTKQMARELAPRIRVNSISPGVVRTKLSEALWKENEDSTSTLIPAGRIGEPEDIADAIAF 240
57117021  145 GMHQSPAMGMYNATKAALIHVTKQLALELSPRIRVNAICPGVVRTRLAEALWKDHEDPLAATIALGRIGEPADIASAVAF 224
54025381  146 GIKPAPGIGFYGASKAMLTYLTQELAVELGPDLRVNAVAPAVVKTKFATALYEGREQELAGTYPLKRLGVPEDIAGAVAF 225
54025459  149 GLRSTGVIAAYGASKAALIRLTEELAWQLGPKIRVNAVAPGVVKTKFADALYSADEERAASVYPMKRLGSPEDVARLIGF 228
119718083 145 GVRPAPGIAMYGASKAMMISLTESLAVELGPSVRVNAVAPAIVKTQFAGPLFEGREDEVAASYPLQRLGVPEDIAGAVAF 224
111019717 146 SIRTAPGIGFYGASKAMLNSLTELMAVELGPDIRINGVAPAVVKTRFATKLYEGREDAVTAAYPLKRLGVPEDIGSVVAF 225
134101894 146 GLKPAPGIGFYGATKAMLAHVTQELAVELGPSIRVNAVAPAVVKTKFATALYEDKEEAVADAYPLKRLGIPSDISGAAAF 225
29833551  147 GVSASPFIGAYGISKAAMINLTLQLAHEFAPKVRVNAIAPAVVKTKFAQALYEGREAEAAASYPLGRLGVPSDIGGAAAF 226
29833801  144 AGHVGPNVGAYGTTKAALLHLTRQLAGELAPKVRVNSVSPGLVRTELARFVWEHGEDELAAGLPLGRIGHPADIARAVVW 223
21219851  147 GLSPSPFIAAYGVSKAALINLTAQLAHEFAPRVRVNAIAPAVVKTKFAAALYEGREEEAAAGYPLGRLGVPSDIGGAAEF 226
68535295  241 LAAPTSSWLTGENLVVDGGMLVGNkTID 268
57117021  225 LVSDAASWITGETMIIDGGLLLGN-ALG 251
54025381  226 LLSDDAAWITGQLLVLDGGITLTG-GV- 251
54025459  229 LASDEAAWITGETVRVDGGLLATG-GI- 254
119718083 225 LLSDDASWVTGQTITLDGGVTLTG-GL- 250
111019717 226 LLSDDAAWVTGQTVVVDGGVSLQSmGE- 252
134101894 226 LLSDDASWVTGQVLVLDGGVTLTG-GV- 251
29833551  227 LTSAQSDWITGQTLVVDGGIFLNA-GVG 253
29833801  224 LASDAAEWITGADLLVDGGTRVRT-AYS 250
21219851  227 LTSEQSAWVTGQTLVVDGGIFLNA-GVA 253
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap