Conserved Protein Domain Family
PRK07670

?
PRK07670: PRK07670 
RNA polymerase sigma factor SigD; Validated
Statistics
?
PSSM-Id: 181075
View PSSM: PRK07670
Aligned: 19 rows
Threshold Bit Score: 399.034
Threshold Setting Gi: 56964009
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 288553039   2 ARVSTNENQKIWDKWLTSRDLDACDELIRLYMPIVNYHVQRISVGLPKNVSKDDLTSHGMLGLYDALEKFNPNRDLKFDT 81
gi 169827149  17 TQPILNDEQKLWNRWIHERDPDAGDLLIKKYISLVSYHVQRISAGLPKSVSRDDLTSLGMIGLFDALNKFDINRDLKFDT 96
gi 56419781    2 GSALKGEERKYWDEWIHGRDRHAAEELVQRYMPLVFYHVQRLSATLPSSVPKDELVSLGLVGLYDALEKFDPSRDLKFDT 81
gi 212639538   1 ---------MCWQKWIDTRDREAGDQLIEKYMPLVDYHVQRIASSLPKSVKKEDLKSLALLGLYDALEKFDPSRDLKFDT 71
gi 138894766   4 ALTLKGDEQKYWDDWVNGRDRHAAEELVQRYMPLVSYHVQRLSATLPSSVPKEELVSLGLVGLYDALEKFDPSRDLKFDT 83
gi 56964009    1 ----MANAAELWKQWDDEHSEVAAEALIEHYMPLVAYHVQRISNGLPSSISKDELKSHALSGLLDAIAKFDSKRALKFDT 76
gi 239826640   2 ANVLTSEERKYWDRWIYHRDPQAGDKLVQTYMPLVHYHVQRIAASLPKTISKQELISLGLMGLYDALEKFDPSRDLKFDT 81
gi 261419446   2 GSALKGEERKYWDEWIHGRDRHAAEELVQRYMPLVFYHVQRLSATLPSSVPKDELVSLGLVGLYDALEKFDPSRDLKFDT 81
gi 297530579   2 GSALKGEERKYWDEWIHGRDRHAAEELVQRYMPLVFYHVQRLSATLPSSVPKDELVSLGLVGLYDALEKFDPSRDLKFDT 81
gi 23099037    2 NMTNSPLEQKLWDKWKNHQDGEAANQLINNYMYLVNYHTERIASHLPNNVVKDDIRSFGILGLYDALKKFDPSRDLKFDT 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 288553039  82 YASFRVRGAIIDGLRKEDWLPRSMREKIKRVEACIQQLEQEFGRNVSAKEVGVKLDMPEEEVYQIMNEHYLSNLLSIDER 161
gi 169827149  97 YASFRVRGAIIDGLRKEDWLPRSAREKAKKLDAQIEQLEQKYMRHVTPEELAKHMEVPVEDVYQTVQEHFFSNVLSINEQ 176
gi 56419781   82 YASFRIRGAILDGLRKEDWLPRSMRDKAKKIEEAIERLEQRHMRSVTAKEIAAELGMTEEEVQAAASETFFSHWLPLGQT 161
gi 212639538  72 YASFRIRGAILDGLRKEDWLPRSVREKAKKIEATIERLQQMHMRDVSAKEVADALNISEDEVYAVMNEQFFANVLSLDER 151
gi 138894766  84 YASFRIRGAILDGLRKEDWLPRSVRDKVKKIEETAERLEQRYMRSVTAKEVAAELGMTEEEVQAAVNETFFSNWLSLGQT 163
gi 56964009   77 YASFRIRGAIIDGLRKEDRLPRTIRDKVKKLEQITEQLEQEKGRSVLPGEVAAAMGLPEKEIEALKREQFASHTLSLDDV 156
gi 239826640  82 YASFRIRGAIFDGLRKEDWLPRSVREKAKKIEETIEKLEQRYMRSVTAKEVADELGITEEEVYMAVNENFFANVLSFQHV 161
gi 261419446  82 YASFRIRGAILDGLRKEDWLPRSMRDKAKKIEGAIERLEQRHMRSVTAKEIAAELGMTEEEVQAAASETFFSHWLPLGQT 161
gi 297530579  82 YASFRIRGAILDGLRKEDWLPRSMRDKAKKIEEAIERLEQRHMRSVTAKEIAAELGMTEEEVQAAASETFFSHWLPLGQT 161
gi 23099037   82 YASFRIKGSIMDGLRKEDWLPRSIREKTKKVEQAMEEYEQSYQREANSSEIANLTGMTTEEVETTMKDALFSNILSIEEK 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 288553039 162 TNDSDRSDsnnsaSYSATLIDKQTKTPEESLMFEAVKEELIKGINRLSENEKLVISLFYFDELTLTEIGHILNLSTSRIS 241
gi 169827149 177 -QDQEEVD-----GKSFVIRDDTTKTPEQSVVKSELLDDLAENIQKLNEKEQLVLSLFYTEELTLTEIGEMLELSTSRIS 250
gi 56419781  162 TVDEDEGL--------LAVRDDRAPLPEEQIVKQEMIEKLAEAIGQLNEKEQLVISLFYKEELTFTEIGSLLHLSTSRIS 233
gi 212639538 152 PFDDDDDQ------PSFTIRDDHSPSPEEHMLREEQIAQLAQVIQQLNEKEQLVISLFYKEELTFTEIGHIMGLSTSRIS 225
gi 138894766 164 ACEEDDEP--------LAIRDDRAVLPEEQVVKQEMIEKLAVGIGQLNEKEQLVISLFYKEELTFTEIGSILQLSTSRIS 235
gi 56964009  157 MHMNDHLDp---sAVAYQFEDEQAIMPDDKLVEEDTRKELAEMIKELGRNEQLVIQLSYYEELSLTEIGRILNLSTSRIS 233
gi 239826640 162 ITENKEEE-----NALLAIRDEKTPSPEEEVLKQELYEKLAEVIQQLSEKEQLVISLFYKEELTFTEIGEILGLSTSRIS 236
gi 261419446 162 TVDEDEGL--------LSVRDDRAPLPEEQIVKQEMIEKLAEAIGQLNEKEQLVISLFYKEELTFTEIGSLLHLSTSRIS 233
gi 297530579 162 TVDEDEGL--------LSVRDDRAPLPEEQIVKQEMIEKLAEAIGQLNEKEQLVISLFYKEELTFTEIGSLLHLSTSRIS 233
gi 23099037  162 PKGNSDQLk---eGIGYSISDERAILPENHIVNEELKEELIQGIKLLNEKEQLVVSLFYNEELTFTEIGQVVGLTTSRIS 238
                        250
                 ....*....|....*.
gi 288553039 242 QIHSKALFRMNQLINK 257
gi 169827149 251 QIHSKALLKLRKLLSS 266
gi 56419781  234 QIHAKALWKLRRFFEK 249
gi 212639538 226 QIHAKALFKMRKLIEQ 241
gi 138894766 236 QIHAKALWKLRRFFAE 251
gi 56964009  234 QIHARAIAKLRKGLQK 249
gi 239826640 237 QLHSKAIFKLRKILEQ 252
gi 261419446 234 QIHAKALWKLRRFFEK 249
gi 297530579 234 QIHAKALWKLRRFFEK 249
gi 23099037  239 QIHKRSIFKLKKTLEK 254
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap