Conserved Protein Domain Family
PRK07661

?
PRK07661: PRK07661 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 181072
View PSSM: PRK07661
Aligned: 42 rows
Threshold Bit Score: 704.203
Threshold Setting Gi: 172058360
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297583444   1 MKEAVIVSGARTPVGKAKKGTLAHVRPDDLGALTIKETLKRANDFDpSRIEDVIIGCAMPEAEQGMNMARNISALAGIPE 80 
169826131   1 MREAVIVAGARTPIGKAKKGSLATVRPDDFGAAVVKETLKRA-GYE-GPIDDLILGCAMPEAEQGMNVARSIGALAGLPD 78 
212640303   1 MKEAVIVAGARTPVGKAKKGTLANVRPDDLGAIVVKETLKRAGNYE-GNIDDLIIGCAMPEAEQGLNIARNIGALAGLPY 79 
138896596   1 MREAVIVAGARTPVGKAKKGTLAHVRPDDLGALVVKETLKRAGNYD-GNIDDLIIGCAMPEAEQGLNVARNIGALAGLPY 79 
229916545   1 MREAVIVAGARTPVGKAKRGSFRNVRSDELAGYAIKATLERS-GYK-GPIDDVIMGCAMPEAEQGMNIARYAAVRGGLSH 78 
288554042   1 MREAVIVAGARTPVGKAKRGTLANVRPDDLGALTIKETLRRAEGFDpAQIDDVIIGCSMPEAEQGMNVARSISALAGLPN 80 
15616049    1 MREAVIVAGARTPVGKAKNGTLANVRPDDLGALTVKETLKRAGDFDpARIDDVIIGCAMPEAEQGMNMARNIAALAGMPH 80 
239828254   1 MREAVIVAGARTPVGKAKKGTLAHVRPDDLGALVVKETLKRAGNYE-GNIDDLIIGCAMPEAEQGLNIARNIGALAGLPY 79 
23099849    1 MKEAVIVAGARTPVGKANKGSLANVRPDDLAALTIKETLKRAGNYD-GNIDDVIIGCATPEAEQGMNMARNVAGLAGLKN 79 
172058360   1 MKEAVIVAGARTPVGKAKKGSFKSMRSDELAGIVIKETLKRA-NYT-GAIDDVILGCALPEAEQGMNIARYASVLGGLSH 78 
297583444  81 QVPAITVNRYCSSGLQSIAYAAERIMLGKASAIIAGGAESMTMIPMGGHVIAPNPTLVDQAPEYYMGMGNTAEEVAERYG 160
169826131  79 TTPALTINRFCSSGLQAIAYAAERIMLGHSKAILAGGVESMSMVPMVGNTPRLNPTLAETAPQYYMGMGHTAEEVARQYN 158
212640303  80 TVPAITINRYCSSGLQAIAYAAERIMLGHADTVIAGGVESMSMVPMMGHVVRPNVKLAESAPEYYMSMGHTAEQVAMKYG 159
138896596  80 TVPAITINRYCSSGLQAIAYAAERVMLGHSDTVIAGGVESMSMVPMMGHVVRPNARLAEEAPEYYMSMGHTAEQVAKKYG 159
229916545  79 EVPAITINRYCSSGLQAIADAAAKIMIGQATAIIAGGMESMSQVPMGGHVIRPNPHIMETAPEYYMSMGHTAERVAAEYN 158
288554042  81 TVPAITINRYCSSGLQSIAYGAERIMLGHSKAIIAGGAESMSMIPMGGHVIAPNPTLVEEQPEYYMGMGYTAEEVANRFG 160
15616049   81 TVPAITINRYCSSGLQSIAYGAERIMLGQGEAIVAGGAESMSLIPMGGHVIAPNPTLVENQPEYYMGMGHTAEEVASRFG 160
239828254  80 TVPAITINRYCSSGLQAIAYAAERIMLGHSDTVIAGGVESMSLVPMMGHVIRPNAKLAEEAPEYYMSMGHTAEQVAMKYG 159
23099849   80 DVPGITINRYCSSGLQSIAYGAERIMVGASDAIIAGGAESMSMLPMGGHVLKPNPKLVESAPGYYMGMGHTAEEVANRFN 159
172058360  79 EVPAITINRYCSSGLQSIADASMKIMTGQATAVIAGGLESMSQVPMPGHVVRPNPSIVETEPEYYMSMGHTAEQVASTYQ 158
297583444 161 VSREDQDAFAVESHKRAANAIKEGKFKDEIVPVPVTHRYVDDNHKLVEKEVLFDTDEGVRTDTTMEGLAKLRPAFNqAGG 240
169826131 159 VSREDQDAFAVRSHVLAEEAIKEGKFNDEIVPIEVEQHYVDENNKPQVKKFTFSMDEGVRSGTSVEGLAKLRPAFH-VKG 237
212640303 160 VTREEQDAFAVRSHQRAAKAIAEGKFVDEIVPVEVTVRHI-ENNKLVEKKMTFSQDEGVRPDTNMETLAKLRPAFS-VNG 237
138896596 160 VSREDQDAFAVRSHQRAAKALAEGKFDEEIVPVEVTVRKV-ENNKLVEEKVVFTQDEGVRPDTNMETLAKLRPAFA-VNG 237
229916545 159 ISREDQDAFAINSHQKAAAAIAGGKFQEEIVPVTVIEHVLGEDGKVAEVEKVVKHDEGVRADSTIEALGKLRPAFK-IKG 237
288554042 161 ISREDQDAFAVESHKRAAAAIEANRFADEIVPVDVTLRAVGPDNKLKEKKVVFDTDEGVRLDTTLEGLAKLRPAFH-PKG 239
15616049  161 VSREDQDAFAVESHKRAAKAIEEGKFADEIVPVDVTLRHVDDNHKLVEKHVTFSVDEGVRPETNMETLSTLRPAFH-AKG 239
239828254 160 VSREDQDAFAVRSHQRAAKAIREGKFKDEIVPVEVTVRKV-ENNKLVEKTILFEEDEGVRPDTNMETLAKLRPAFS-VNG 237
23099849  160 ISREDQDAFAVQSHQRAAKALEEGKFDDEIVPVEVSQRLVGQNNKVEEKSFIFDQDEGVRAGTTSEILSKLRPAFH-VKG 238
172058360 159 VSREDQDAFALKSHQKAAAAIASGKFADEIVPVTVTEQFVNDELKIEEKTWVVEHDEGVRADSSPEGLAKLRPAFR-LGG 237
297583444 241 TVTAGNASQMSDGAASVLVMDKETAEKEGLQPMAKFLAYEVAGVAPDVMGIGPVEAIPKALKSAGLDFGDIGLYELNEAF 320
169826131 238 SVTAGNASQTSDGAAAVLVMEREEAVKQGLTPMAKFLGFAVGGVPPEVMGIGPIVAVPKALEIAGLSIDAIDLWEINEAF 317
212640303 238 TVTAGNASQTSDGAAAVMVMDHEKAKALGLQPLGKFRSFAVAGVPPEVMGIGPIAAIPKALKLAGLELSDIGLIELNEAF 317
138896596 238 TVTAGNASQMSDGAAAVMVMDREKAESLGLKPLGKFRSFAVAGVPPEVMGIGPVAAVPKALKLAGLELSDIGLIELNEAF 317
229916545 238 SVTAGNASQVSDGAAAVLVMDREEAERQGLQPMAKFLSFAVGGVRPEVMGIGPVVAIPKALEMAGVKLEEVGLFELNEAF 317
288554042 240 SVTAGNSSQMSDGAASVLLMDREEAEASGLQPLLKFRSFAVAGVAPEIMGIGPVEAIPKALKLAGLDISDIGLFELNEAF 319
15616049  240 TVTAGNASQMSDGAAAVLLMDREVAEREGLTPVVKFRSFAVAGVAPEIMGVGPVEAIPKAVKMAGLDLSDIGLFELNEAF 319
239828254 238 TVTAGNASQMSDGAAAVMVMDREKAESLGLKPLGKFRSFAVAGVPPEVMGIGPVAAVPKALKLAGLELSDIGLIELNEAF 317
23099849  239 SVTAGNASQMSDGAASVLLMERGKAEAEGLTPLLKFRSFAVAGVEPEIMGVGPVEAIPKALKIAGLELSDIGLFELNEAF 318
172058360 238 SVTAGNSSQTSDGAAAVLIMEREEAERQGLPILGKFKSFAVGGVRPEVMGIGPVVAIPKALELAGITLEEVGLIELNEAF 317
297583444 321 ASQSLQVIRELGLDPEKVNVNGGAIALGHPLGCTGTKLTLSLLHEMKRRGEKYGVVTMCIGGGMGAAGVFELM 393
169826131 318 ASQSLQVVRHLGIDQDKVNVNGGAIALGHPLGATGAILTLKLIHELKRQGKKYGVVTMCIGGGMGAAGVFEIL 390
212640303 318 ASQAIQVIRELGLDEEKVNVNGGAIALGHPLGCTGAKLTLTLLHEMRRRNEQFGIVTMCIGGGMGAAGVFELL 390
138896596 318 ASQSVQVIRELGLDEEIVNVNGGAIALGHPLGCTGAKLTLSLLYEMRRRNVQFGIVTMCIGGGMGAAGVFELL 390
229916545 318 ASQSLGVIRELGIDPSKVNVNGGAIALGHPLGCTGAKLSVSILHEMKRRNEKYGVVTMCIGGGMGAAGVFELL 390
288554042 320 ASQSLQVIRHLELDTNKVNVNGGAIALGHPLGCSGTKLTLSLMHEMKRRGEQFGVVTMCIGGGMGAAGVFELI 392
15616049  320 ASQAIQVIRGLNLDHDKVNVNGGAIALGHPLGCTGTKLTLSLIHEMKRRGEQFGVVTMCIGGGMGAAGVFELI 392
239828254 318 ASQSIQVIRELGLDEEKVNVNGGAIALGHPLGCTGAKLTLSLLYEMRRRNVQFGIVTMCIGGGMGAAGVFELI 390
23099849  319 ASQSLRVIQALDLNMDKVNVNGGAIALGHPLGCTGTKLTLSLMHEMKRRNEQFGVVTMCIGGGMGAAGVFELL 391
172058360 318 ASQSLGVIRELGLNEDIVNVNGGAIALGHPLGCTGTKLTLTLLHEMKRRNVQYGVVSMCIGGGMGAAGVFELV 390
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap