Conserved Protein Domain Family
PRK07627

?
PRK07627: PRK07627 
dihydroorotase; Provisional
Statistics
?
PSSM-Id: 181059
View PSSM: PRK07627
Aligned: 46 rows
Threshold Bit Score: 620.541
Threshold Setting Gi: 33591553
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33603376    4 RTVRIAGGRLIDPASGADARADLYLADGRIAAIGQAPAGFQAQQHIDARGLAVLPGLVDLSARVHGAGL---APLACEMQ 80
gi 33598436    4 RTVRIAGGRLIDPASGADARADLYLADGRIAAIGQAPAGFQAQQHIDARGLAVLPGLVDLSARVHGAGL---APLACEMQ 80
gi 33591553    4 RTVRIAGGRLIDPASGADARADLYLADGRIAAIGQAPAGFQAQQHIDARGLAVLPGLVDLSARVHGAGL---APLACEMQ 80
gi 30249628    1 MHIHIRNGRLIDPGSGMDRTDDLYLAEGKIVSIGSRPDGFHDDREIEAGGMIVCPGLVDLSARLREPGLeymATLESELE 80
gi 114330472   1 MHICIQNGRLIDPDSGMDRIGDLYLAEGRIISIDSRPEHFHDDREIDASGLVVCPGLVDLSARLREPGLeymATLESELE 80
gi 74318601    1 MKIHIKNGRVIDPASGRDEIADLFIAAGRIV--TSDAPTFHANRTIDASGLVVCPGLVDLSVRLREPGFeykATLESEML 78
gi 119899752   1 MKIQITNGRLIDPANNIDAQQDVYIVGGRVAGLGRAPEGFQADRVIDASGLVVAPGLIDLAARLREPGFeyrATLESEMD 80
gi 237654355   1 MNILISNGRVVDPANRTDAVQNVYVAGGKIVALGQAPDGFVAERTIDAGGLVVAPGFIDLAARLREPGYeyrATLESEME 80
gi 82703597    1 MNIAIRNGRVIDPKNSFDRVTDIYIQSGKIASLGAVPPGFEARREINAQGLIVCPGLVDLSARLREPGLeykATLESEMG 80
gi 71909500    1 MNIVIENGRVIDPKNGVDRRASLYVADGKVAGIGQVPAGFVADRSIDAAGCVVCPGFIDLGARL--------NSIEAELA 72
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33603376   81 AALAGGVTRLVVPPDTDPPLDEPGRVEMLRHRAHQAGQAQLHPLGALTEGLRGERLSEMAALAEAGCVAFSQAGLPVADT 160
gi 33598436   81 AALAGGVTRLVVPPDTDPPLDEPGRVEMLRHRAHQAGQAQLHPLGALTEGLRGERLSEMAALAEAGCVAFSQAGLPVADT 160
gi 33591553   81 AALAGGVTRLVVPPDTDPPLDEPGRVEMLRHRAHQAGQAQLHPLGALTEGLRGERLSEMAALAEAGCVAFSQAGLPVADT 160
gi 30249628   81 AAVAGGVTSLACPPDTDPPLDEPGLVEMLKHRARNLDQARVYPVGALTQGLKGARLTEMVELHDAGCVAFSQVDAPIANL 160
gi 114330472  81 AAVAGGVTSLACPPDTDPPLDEPGLVEMLKHRARNLDRARVYPVGALTQGLKGERLTEMVELHDAGCVAFSQADAPIANL 160
gi 74318601   79 AAAAGGVTSLACPPDTDPPLDEPGLVEMLKFRAKNLPGPRVYPVGALTQKLEGKMLTEMAELTEAGCRAFTQADAPLTDT 158
gi 119899752  81 AAMAGGVTSLAIPPDTDPALDEPGLVEMLCYRAKKLNRAHVYPVGALTIGLKGERLSEMAELVEAGCVAFSQANVPIVDN 160
gi 237654355  81 AAMAGGVTSLAIPPDTDPVLDEPGLVEMLTYRAKKLNRAHIYPVGALTIGLQGERLSEMAELVEAGCVAFSQANVPLVDN 160
gi 82703597   81 AAVAGGVTSLACPPDTDPVLDEPGLVEMLKYRARSRNQTRVYPIGALTRGLRGEWLTEMAELHSAGCVAFGQSDRPLPNN 160
gi 71909500   73 AAVAGGVTTVVVPPDADPPLDEPELADRLVHRGEEIGKARVLPLGALTLGLKGERLAELAGLKKAGCVAFSQANKTVVDT 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33603376  161 RVLWRAMQYARTFGLALWLRPLDPWMGRDGVAAAGAYASRLGLAEVPVQAETLALHTIFELQRATGARVHLMRLSSAAGV 240
gi 33598436  161 RVLWRAMQYARTFGLALWLRPLDPWMGRDGVAAAGAYASRLGLAEVPVQAETLALHTIFELQRATGARVHLMRLSSAAGV 240
gi 33591553  161 RVLWRAMQYARTFGLALWLRPLDPWMGRDGVAAAGAYASRLGLAEVPVQAETLALHTIFELQRATGARVHLMRLSSAAGV 240
gi 30249628  161 HVLMRAMQYAATFGFKVWLRPQDIHLANHGVAHEGEIATRLGLPAIPVCAETIALASILSLMKETGASVHLCRISSAEGT 240
gi 114330472 161 HVLMRAMQYAATFGFKVWLRPQDMYLANHGVAHDGEVATRLGLPAIPVCAETIALTDILSLMKETGASAHLCRISSAEGV 240
gi 74318601  159 LVLLRAMEYAATFGFRLWLRAQDVTLARGGIAHDGAIASRLGLPGIPALAETVALATILQLMRETGARVHLARLSTREGI 238
gi 119899752 161 AVLMRAMQYAATFGFRVWLQPIAPFLARGGYAHDGEFASRIGLPGIPVAAETVALYTYLQLAGMTGARLHITRLSSAAGL 240
gi 237654355 161 TVLMRALQYAATFGFRVWLQPLAPFLSQVGHAHDGEVATRLGLSGIPVAAETVALYTYLELARITGARLHITRLSSAAGL 240
gi 82703597  161 RVLMQAMQYASTFGFCLWLRPQDVNLADGGVAHDGEVATRLGLAPIPVCAETVALSHIILMAKETGARVHLCRISSAEGV 240
gi 71909500  153 EALLRALEYAATFDFAVWLQPQDYWLSRNGIAHEGEVASRLGLAGIPVAAETIAIGTIIQLVRDTGCRIHLTRISSAAGM 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33603376  241 ALVRAARREGLPLTCDVAAHQIHLTDVDIGFFDSRFRLDPPLRGQRDRDAIVAGLADGTIDAICSDHRPVGDTGKLLPFA 320
gi 33598436  241 ALVRAARREGLPLTCDVAAHQIHLTDVDIGFFDSRFRLDPPLRGQRDRDAIVAGLADGTIDAICSDHRPVGDTGKLLPFA 320
gi 33591553  241 ALVRAARREGLPLTCDVAAHQIHLTDVDIGFFDSRFRLDPPLRGQRDRDAIVAGLADDTIDAICSDHRPVGDTGKLLPFA 320
gi 30249628  241 ALVRAAKRQGLPLTCDVSINHVHLTDMDIGFFDANCHLMPPLRSLADRDALCVGLMDGTIDAICSDHAPVDEDAKSLPFA 320
gi 114330472 241 ALVRAAKQQGLPLTCDVSIHHVHLVDMDIGFFDANCHLMPPLRGLADRDALRAGLMDGAIDTICSDHAPVDDDAKLLPFA 320
gi 74318601  239 AMVQAAKAQGLAVTCDVATTHVHLSENDLVGFDSHLHLVPPLRSLRDRDAIREALRDGAVDALCSDHTPVDEDEKQVPFG 318
gi 119899752 241 ALIEQARADGMDVTCDVSINHLHLCDTDIGYFNANCHLVPPLRSQRDREALCRGLADGRINALCSDHTPVDDDGKLTPFS 320
gi 237654355 241 ALIDQARAEGMDVTCDVSINHVHLCDMDIGYFNPNCHLVPPLRSQRDREALARGLAEGRIDALCSDHTPVDDDAKQTPFS 320
gi 82703597  241 TMTRAARKQGLSITCDVAANHVHLSEMDIGFFDSNCHLVPPLRSLGDRDALRAGLLDGTIDAICSDHAPVDEDAKLLPFA 320
gi 71909500  233 ALVHRAQHDGLPISCDVGVHHLLLTENDIGFFNPHARFCPPLRAQTDRQALSDAVVAG-WAAICSDHTPVGADDKLLPFG 311
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33603376  321 EAEAGASGLELLLSLTLKWAQRERVPLARALALVTSAPAAILRaataaLpPCGELAAGAPADLCLVDLDADWTAAPAAMR 400
gi 33598436  321 EAEAGASGLELLLSLTLKWAQRERVPLARALALVTSAPAAILRaataaLpPCGELAAGAPADLCLVDLDADWTAAPAAMR 400
gi 33591553  321 EAEAGASGLELLLSLTLKWAQRERVPLARALALVTSAPAAILRaataaPpPCGELAAGAPADLCLVDLDAD--------- 391
gi 30249628  321 QAESGATGLELLLPLTLKWAVENRLSLPEALARITFHPARILG-----I-ETGQLAIGAVADLCIFDPDANWVVSHTELR 394
gi 114330472 321 QAETGATGLELLLPLTLKWAMESRLSLPEALARITSYPARILG-----I-DAGRLVAGAPADLCIFDPDAYWVVSNAELK 394
gi 74318601  319 ESSPGASGVELLLPLTLKWAREMNVPLPRALALITCEPARILD-----I-PAGELAAGANADVCIFDAQAEWVVTSKSLA 392
gi 119899752 321 ESEAGATGLELLLPLTLKWAQEAGVPLPLALGRITTDAARIVG-----ItKAGHLGVGARADICVFDPAAYVKISREGLR 395
gi 237654355 321 ESEPGATGLELLLPLTLKWADRAGLALLDGLARITSDAAKIVG-----ItKAGHLSVGARADVCVFDPATHVTITREGLR 395
gi 82703597  321 EAEAGATGLELLLPLTLKWAAETKLPLVVALSKITREPARILG-----V-EAGHLTPGGNADLCIFDPDHYWTIEAPTLK 394
gi 71909500  312 EAKPGATGLEVLLPLTLKWADAAKVDLPTALARITSAPAAVLG-----L-ASGQLAIGTTADICIFDPEANWQLTPDALK 385
                        410       420       430
                 ....*....|....*....|....*....|.
gi 33603376  401 SRSVHTPFAGMMLPGRVRATLVAGRTVWETP 431
gi 33598436  401 SRSVHTPFAGMMLPGRVRATLVAGRTVWETP 431
gi 33591553      -------------------------------
gi 30249628  395 SQGKNTPFLGMELYGRTRFTLIGGRIVYG-- 423
gi 114330472 395 SQGKNTPFLGMELCGRTRFTLISGHVVYG-- 423
gi 74318601  393 SQGDNTPFLNHPMQGRVRYTLIDGHIDFESA 423
gi 119899752 396 SQGKNTPFLGLELPGQVRYTLVEGQVMFARA 426
gi 237654355 396 SQGKNTPFLGMELPGKVRYTLVEGQVMFEG- 425
gi 82703597  395 SQGKNTPFLGWELQGKVKYTLINGNVVYVD- 424
gi 71909500  386 SRGKNSPWLGYVMTGKVKATLVGGRPVYQA- 415
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap