Conserved Protein Domain Family
PRK07625

?
PRK07625: PRK07625 (this model, PSSM-Id:102980 is obsolete)
DNA polymerase I; Provisional
Statistics
?
PSSM-Id: 102980
View PSSM: PRK07625
Aligned: 24 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73540576    4 SPKTLLLVDGSSYLYRAYHALPDLRNGEGLPTGAIYGMINMLRKLRNDYPAEYSACVFDAKGKTFRDEMYPAYKEHRPSM 83
gi 33602215    1 MKKTLLLVDGSSYLYRAFHAMPDLRNAQGEPTGALYGVVNMLRKLVQDHKAEYAVCVFDARGKTFRDDLFPDYKSHRPPM 80
gi 33596490    1 MKKTLLLVDGSSYLYRAFHAMPDLRNAQGEPTGALYGVVNMLRKLVQDHKAEYAVCVFDARGKTFRDDLFPDYKSHRPPM 80
gi 33592382    1 MKKTLLLVDGSSYLYRAFHAMPDLRNAQGEPTGALYGVVNMLRKLVQDHKAEYAVCVFDARGKTFRDDLFPDYKSHRPPM 80
gi 161521363   8 EGKTLLLVDGSSYLYRAYHAMPDLRGPGGEPTGALYGIINMLRRMRKEVSAEYSACVFDAKGKTFRDDLYADYKANRPSM 87
gi 91777303    8 EGKTLLLVDGSSYLYRAYHAMPDLRGPDGGPTGALYGMINMLRRMRKEVTAEYSACVFDAKGKTFRDDWYADYKANRPSM 87
gi 107026837   8 EGKTLLLVDGSSYLYRAYHAMPDLRGPGGEPTGALYGIINMLRRMRKEVSAEYSACVFDAKGKTFRDDLYADYKANRPSM 87
gi 116691969   8 EGKTLLLVDGSSYLYRAYHAMPDLRGPGGEPTGALYGIINMLRRMRKEVSAEYSACVFDAKGKTFRDDLYADYKANRPSM 87
gi 113868699   4 SPKTLLLVDGSSYLYRAYHALPDLRNGEGLPTGAIYGMINMLRKLRNDYPAEYSACVFDAKGKTFRDDMYPAYKEHRPSM 83
gi 94311560    4 SPKTLLLVDGSSYLYRAYHALPDLRNGEGLPTGAIYGMINMLRKLRNDYPAQYIACVFDAKGKTFRDDMYPAYKEHRPSM 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73540576   84 PEDLARQIEPIHEAVRALGWPIVVVEGVEADDVIGTLARQAAEQGVRTVVSTGDKDLAQLVNDQVTLVNTMSGEVLDPAG 163
gi 33602215   81 PEDLAAQIEPIHEAVRALGWPLLAIEGVEADDIIGTLARQASAQGIDTIVSTGDKDLAQLVDPHVTLVNTMSGEVLDVAG 160
gi 33596490   81 PEDLAAQIEPIHEAVRALGWPLLAIEGVEADDIIGTLARQASAQGIDTIVSTGDKDLAQLVDPHVTLVNTMSGEVLDVAG 160
gi 33592382   81 PEDLAAQIEPIHEAVRALGWPLLAIEGVEADDIIGTLARQASAQGIDTIVSTGDKDLAQLVDPHVTLVNTMSGEVLDVAG 160
gi 161521363  88 PPDLALQVEPIHGAVRALGWPLLMVEGVEADDVIGTLAREAERRGMNVIVSTGDKDLAQLVSDRVTLVNTMTNETLDRDG 167
gi 91777303   88 PDDLSRQIEPIHVAVRALGWPLLMIEGVEADDVIGTLSTEAEKRGMNVIVSTGDKDLAQLVSDHVTLINTMTNEKLDRAG 167
gi 107026837  88 PPDLALQVEPIHGAVRALGWPLLMVEGVEADDVIGTLAREAERHGMNVIVSTGDKDLAQLVTERVTLVNTMTNETLDRDG 167
gi 116691969  88 PPDLALQVEPIHGAVRALGWPLLMVEGVEADDVIGTLAREAERHGMNVIVSTGDKDLAQLVTERVTLVNTMTNETLDRDG 167
gi 113868699  84 PEDLARQIEPIHEAVRAMGWPIVVVDGVEADDVIGTLSRQATEQGVRTVVSTGDKDLAQLVNDQVTLVNTMSGEVLDPPG 163
gi 94311560   84 PEDLAKQIEPIHEAVRALGWPIVVVEGVEADDVIGTLALQASQQGVNTVVSTGDKDLAQLVNDTVTLVNTMSGEVLDPPG 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73540576  164 VNAKFGVPPERIVDYLSLIGDAVDNVPGVPKVGPKTAVKWLTEHGTLDNIMAGAAGIKGVVGENLRNTLDWLPKARELVT 243
gi 33602215  161 VNNKFGVPPERIVDYLMLVGDTVDNVPGVNKVGPKTAVKWLAEHGSIDALVAAADSVKGVAGNNLREAIPNFPLTRTLLT 240
gi 33596490  161 VNSKFGVPPERIVDYLMLVGDTVDNVPGVNKVGPKTAVKWLAEHGSIDALVAAADSVKGVAGNNLREAIPNFPLTRTLLT 240
gi 33592382  161 VNSKFGVPPERIVDYLMLVGDTVDNVPGVNKVGPKTAVKWLAEHGSIDALVAAADSVKGVAGNNLREAIPNFPLTRTLLT 240
gi 161521363 168 VLAKFGVPPERIVDYLALIGDTVDNVPGVEKCGPKTAVKWLTQYGSLDGVIEHAGEIKGVVGDNLRRALDFLPLGRKLVT 247
gi 91777303  168 VLAKFGVPPERIIDYLSLVGDTVDNVPGVEKCGPKTAVKWLTQFDSLDGIVAHADEIKGAVGDNLRRALDFLPMAKKLVT 247
gi 107026837 168 VIAKFGVPPERIIDYLALIGDTVDNVPGVEKCGPKTAVKWLTQYDTLDGVIEHAADIKGVVGDNLRRALDFLPLGRQLVT 247
gi 116691969 168 VIAKFGVPPERIIDYLALIGDTVDNVPGVEKCGPKTAVKWLTQYDTLDGVIEHAADIKGVVGDNLRRALDFLPLGRQLVT 247
gi 113868699 164 VVAKFGVPPERIIDYLSLIGDAVDNVPGVPKVGPKTAVKWLAEHGSLDGVIAAAPGIKGVVGENLRNTLDWLPMARQLVT 243
gi 94311560  164 VVAKFGVPPERIVDYLSLIGDAVDNVPGVPKVGPKTAVKWLTEYGTLDDIMGNAEKIKGVVGENLRNTLEWLPRARELVT 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73540576  244 VKTDCDLSAAVADFHA-LREIGEDKEKLIAFFTRYGFKTWLREATGESLPDARaqararaaaapaqgglfdapaatssal 322
gi 33602215  241 VKCDCDLTGHVSDWED-LAWRERDAATLTALFDRYGFRTWLRELTGDQERLPT--------------------------- 292
gi 33596490  241 VKCDCDLTGHVSDWED-LAWRERDAATLTALFDRYGFRTWLRELTGDQERLPT--------------------------- 292
gi 33592382  241 VKCDCDLTGHVSDWED-LAWRERDAATLTALFDRYGFRTWLRELTGDQERLPT--------------------------- 292
gi 161521363 248 VETACDLAPHLESIDAsLKSDGEARDLLRDIFARYGFKTWLREVDSAPAEGGGad------------------------a 303
gi 91777303  248 VERNCDLTDHIVSIGEsLQSQPESRAELREVFTRHGFKTWLREVEIADAVEG---------------------------- 299
gi 107026837 248 VDTSCDLTPHLESIEAsLKSDGEARDLLRDIFARYGFKTWLREVDSAPAEGGGad------------------------a 303
gi 116691969 248 VDTSCDLTPHLESIEAsLKSDGEARDLLRDIFARYGFKTWLREVDSAPAEGGGad------------------------a 303
gi 113868699 244 VKTDCDLSAAVADFHA-LRETGEDKDKLVAFFSRYGFKTWLREATGESLPDARaqararaaaapa---qgglfdvpatag 319
gi 94311560  244 VKTDCDLSGAVADFQA-LHDLGEDKEKLIAFFQRYGFKSWLREATGESLPNARaaaravpkaa-------paqgglfdap 315
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73540576  323 AAETPPAEDMAPSEIRYELVTTEAAFEAWMQRIESAPLTAIDTETTSLDPMLAQLVGISLSVEPGEACYIPVGHRGPDVA 402
gi 33602215  293 GDARAVPQAVAPAELDYRIITDWAAFDAWMALVEDAPLVALDTETTSLDEMQARLVGLSMAVKPGVACYIPVAHRGPEAG 372
gi 33596490  293 GDARAVPQAVAPAELDYRIITDWAAFDAWMALVEDAPLVALDTETTSLDEMQARLVGLSMAVKPGVACYIPVAHRGPEAG 372
gi 33592382  293 GDARAVPQAVAPAELDYRIITDWAAFDAWMALVEDAPLVALDTETTSLDEMQARLVGLSMAVKPGVACYIPVAHRGPEAG 372
gi 161521363 304 PDGEPAPVIAVDTPREYETIQTWEQFDAWFAKLEAAELTAFDTETTALDPMVARLVGLSFAVEPGKAAYLPVAHRGPDMP 383
gi 91777303  300 PETDVPPALSVDHERHYDTVQTWEQFDAWLGKINAAELTSFDTETTSLDPMIAQIVGLSLSVEAGRAAYVPLAHRGPDAP 379
gi 107026837 304 PEGEPAPVIAADVVREYDTIQTWEQFDAWFAKIDAAALTAFDTETTALDPMLARLVGLSFSVEPGKAAYLPVAHRGPDMP 383
gi 116691969 304 PEGEPAPVIAADVVREYDTIQTWEQFDAWFAKIDAAALTAFDTETTALDPMLARLVGLSFSVEPGKAAYLPVAHRGPDMP 383
gi 113868699 320 AAEAPAADQAAPTEIRYDTVSTEAQLEDWMRRIEAAPLVAIDTETTSLDPMQAQLVGISLSVEPGVACYIPVAHRGPDVA 399
gi 94311560  316 AQADAPAEDVPPAEIRYETVTTEAALDEWLRKIADAPIVAIDTETTSLDPMLAQLVGISLSVEPGAAAYIPVAHRGPDVA 395
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73540576  403 gmennGQLSRDTVLARMRAWLEDDSKPKLGQNIKYDIHVFANHGVTLCGVAQDTMLESYVLASHRNHGMDSLAERLLNLK 482
gi 33602215  373 -----DQLPRDEVIARLRGWLEDAGRAKLLHHAKYDTHVFANEGVSLAGVAEDTMLQAYVLESHRGVGLNDLAQRFLGRS 447
gi 33596490  373 -----DQLPRDEVIARLRGWLEDAGRAKLLHHAKYDTHVFANEGVSLAGVAEDTMLQAYVLESHRGVGLNDLAQRFLGRS 447
gi 33592382  373 -----DQLPRDEVIARLRGWLEDAGRAKLLHHAKYDTHVFANEGVSLAGVAEDTMLQAYVLESHRGVGLNDLAQRFLGRS 447
gi 161521363 384 -----EQLPLDDVLARLKPWLESPDRKKVGQHLKYDAQVLANYGIELNGIEHDTLLESYVLESHRTHDMDSLALRHLGVK 458
gi 91777303  380 -----VQLPRDEVLARLKPWLESAGHKKVGQHLKYDEQVLANYGIEMRGIEHDTLLQSYVVESHRTHDMDSLALRHLGVK 454
gi 107026837 384 -----EQLPLDEVLARLKPWLESADRKKVGQHLKYDAQVLANYDIALNGIEHDTLLESYVVESHRTHDMDSLALRHLGVK 458
gi 116691969 384 -----EQLPLDEVLARLKPWLESADRKKVGQHLKYDAQVLANYDIALNGIEHDTLLESYVVESHRTHDMDSLALRHLGVK 458
gi 113868699 400 glpdhGQLSREFVLGRMRAWLEDASRPKLGQNLKYDVHVFANHGVKLRGVAHDTMLQSYVLASHRNHGMDSLAERLLSLK 479
gi 94311560  396 glenhGQLSREYVLERMRGWLEDPARPKLGQHLKYDSHVFANHGVALRGIAHDTMLESYVLASYRNHGMDSLAERLLSLK 475
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73540576  483 TITYEEVCGKGASQIGFDQIDLARATEYAAEDADVTLRLHRKMFPQVSAAAGLRRVYEeIEIPVSVVLQKIERNGVLIDA 562
gi 33602215  448 GVNYEDLCGKGAKQIGFDEVAVALAGHYSCEDSDFTLQLHEVLRPRVAEDEGLERTYL-LELQVSRVLTVVERNGVKVDA 526
gi 33596490  448 GVNYEDLCGKGAKQIGFDEVAVPLAGHYSCEDSDFTLQLHEVLRPRVAEDEGLERTYL-LELQVSRVLTVVERNGVKVDA 526
gi 33592382  448 GVNYEDLCGKGAKQIGFDEVAVPLAGHYSCEDSDFTLQLHEVLRPRVAEDEGLERTYL-LELQVSRVLTVVERNGVKVDA 526
gi 161521363 459 TIKYEDVAGKGAKQIGFDEVALAQAAEYAAEDADITLQLHRALYPQIAREPGLERVYReIEMPVSLVLRKMERNGVLIDD 538
gi 91777303  455 TIKYEEVAGKGAGQIGFDEVALDKAAEYAAEDADITLRLHQVLYPQVAAEKTLQYVYHdIELPTSRVLRKMERTGVLIDS 534
gi 107026837 459 TIKYEDVAGKGAKQIGFDEVALAQAAEYAAEDADITLQLHHALYPQVAREPGLERVYReIEMPVSLVLRKMERTGVLIDD 538
gi 116691969 459 TIKYEDVAGKGAKQIGFDEVALAQAAEYAAEDADITLQLHHALYPQVAREPGLERVYReIEMPVSLVLRKMERTGVLIDD 538
gi 113868699 480 TITYEEVCGKGASQIGFDQIDLARATEYAAEDADVTLRLHRKMFPQVEAAAGLRRVYEeIEMPVSVVLQKVERNGVLIDA 559
gi 94311560  476 TITYEEVCGKGANQIGFDQIDLPRATEYAAEDADVTLRLHRKMQPQLEASEGLKYVYEqIEIPVSVVLQKIERNGVLIDA 555
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73540576  563 ERLAAQSAELGQRMLSLEQAAYDAAGQPFNLGSPKQIGEILFNQMKLPVVKKTASGAPSTDEEVLQKLAEDYPLPKLLLD 642
gi 33602215  527 QELGRQSHKLGQEMLALEQRAYELAGQPFNLNSPKQLGEILFGRMGLPVVRKTAGGAPSTDEEVLSKLAQDYPLPQVLLE 606
gi 33596490  527 QELGRQSHKLGQEMLALEQRAYELAGQPFNLNSPKQLGEILFGRMGLPVVRKTAGGAPSTDEEVLSKLAQDYPLPQVLLE 606
gi 33592382  527 QELGRQSHKLGQEMLALEQRAYELAGQPFNLNSPKQLGEILFGRMGLPVVRKTAGGAPSTDEEVLSKLAQDYPLPQVLLE 606
gi 161521363 539 ARLQAQSNEIATRLVDLEAQAYALAGGEFNLGSPKQIGQIFFEKLQLPVVKKTPSGAPSTDEEVLQKLAEDYPLPKLLLE 618
gi 91777303  535 EKLRQQSSEIATRLIQLESEAYVLAGGEFNLGSPKQIGQIFFEKLELPVVKKTPSGAPSTDEEVLQKLAEDFPLPKILLE 614
gi 107026837 539 ARLHAQSTEIATRLIELEGEAYELAGGEFNLGSPKQIGQIFFEKLQLPVVKKTPSGAPSTDEEVLQKLAEDYPLPKLLLE 618
gi 116691969 539 ARLHAQSTEIATRLIELEGEAYELAGGEFNLGSPKQIGQIFFEKLQLPVVKKTPSGAPSTDEEVLQKLAEDYPLPKLLLE 618
gi 113868699 560 ERLAAQSAELGQRMLALEQAAYEAAGQPFNLGSPKQIGEILFSQMKLPVVKKTASGAPSTDEEVLQKLAEDYPLPKLLLD 639
gi 94311560  556 DRLAAQSAELGLRMMDLERAAHDAAGQPFNLGSPKQIGEILFNQMKLPVVKKTASGAPSTDEEVLQKLADDYPLPKLLLD 635
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73540576  643 YRGLAKLKSTYTDKLPKMVNPNTGRVHTSYGQATAVTGRLASTEPNLQNIPVRTEEGRRIREAFIASPGsVIVSADYSQI 722
gi 33602215  607 YRGLSKLKSTYTDKLPRMINPATGRVHTHYSQAAVITGRLASSDPNLQNIPVRTEAGRRVREAFIAEQG-KLLSADYSQI 685
gi 33596490  607 YRGLSKLKSTYTDKLPRMINPATGRVHTHYSQAAVITGRLASSDPNLQNIPVRTEAGRRVREAFIAEQG-KLLSADYSQI 685
gi 33592382  607 YRGLSKLKSTYTDKLPRMISPATGRVHTHYSQAAVITGRLASSDPNLQNIPVRTEAGRRVREAFIAEQG-KLLSADYSQI 685
gi 161521363 619 HRGLSKLKSTYTDKLPRMVNPSTGRVHTNYAQAVAVTGRLASNDPNLQNIPVRTAEGRRIREAFIAAPGhRIVSADYSQI 698
gi 91777303  615 HRGLSKLKSTYTDKLPRMVNATTGRVHTNYAQAVAVTGRLASNDPNLQNIPVRTGEGRRIREAFIAPAGhKLVSADYSQI 694
gi 107026837 619 HRGLSKLKSTYTDKLPRMVNPTTGRVHTNYAQAVAVTGRLASNDPNLQNIPVRTAEGRRIREAFIASPGhRIVSADYSQI 698
gi 116691969 619 HRGLSKLKSTYTDKLPRMVNPTTGRVHTNYAQAVAVTGRLASNDPNLQNIPVRTAEGRRIREAFIASPGhRIVSADYSQI 698
gi 113868699 640 YRGLAKLKSTYTDKLPKMVNPQTGRVHTSYGQATAVTGRLASTEPNLQNIPVRTEEGRRIREAFIAEPGsVIVSADYSQI 719
gi 94311560  636 YRGLSKLKSTYTDKLPKMVNPNTGRVHTSYGQATAVTGRLASTDPNLQNIPVRTEEGRRIREAFIAAPGnVIVSADYSQI 715
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73540576  723 ELRIMAHISGDENLLRAFANGEDIHRATASEIFGVDREAVSSEQRRYAKVINFGLIYGMSAFGLASNLGIEREAAKHYID 802
gi 33602215  686 ELRIMAHVSDDANLQRAFAAGEDIHRATASEVFGVPLAEVGAEQRRAAKAINFGLIYGMGVFGLASNLGITRDAAQAYID 765
gi 33596490  686 ELRIMAHVSDDANLQRAFAAGEDIHRATASEVFGVPLAEVGAEQRRAAKAINFGLIYGMGVFGLASNLGITRDAAQAYID 765
gi 33592382  686 ELRIMAHVSDDANLQRAFAAGEDIHRATASEVFGVPLAEVGAEQRRAAKAINFGLIYGMGVFGLASNLGITRDAAQAYID 765
gi 161521363 699 ELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLEVNADQRRIAKVINFGLIYGMSAFGLASNLGITRDAAKLYID 778
gi 91777303  695 ELRIMAHISGDESLLHSFSQGEDIHRATAAEIFSVTPLEVSNDQRRVAKVINFGLIYGMSSFGLASNLGITRDAAKLYID 774
gi 107026837 699 ELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLEVNSDQRRIAKVINFGLIYGMSAFGLASNLGITRDAAKLYID 778
gi 116691969 699 ELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLEVNSDQRRIAKVINFGLIYGMSAFGLASNLGITRDAAKLYID 778
gi 113868699 720 ELRIMAHISGDENLLRAFANGEDIHRATAGEIFGVEREAVSSEQRRYAKVINFGLIYGMSAFGLAGNLGIEREAAKHYID 799
gi 94311560  716 ELRIMAHISGDENLLRAFANGEDIHRATAGEIFGVEREAVSSEQRRYAKVINFGLIYGMSAFGLASNLGIEREAAKHYID 795
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73540576  803 RYFMRYPGVAQYMEDTRQTAREQGYVETVFGRRLWLPDINGGSGPRRQAAERAAINAPMQGTAADLIKLSMIAVQGWLER 882
gi 33602215  766 RYFTRYPGVARYMDDTRRLARDQGYVETVFGRRLQLPDIRAASGPRRQGAERAAINAPMQGTAADLIKMAMVAVQDWLDA 845
gi 33596490  766 RYFTRYPGVARYMDDTRRLARDQGYVETVFGRRLQLPDIRAASGPRRQGAERAAINAPMQGTAADLIKMAMVAVQDWLDA 845
gi 33592382  766 RYFTRYPGVARYMDDTRRLARDQGYVETVFGRRLQLPDIRAASGPRRQGAERAAINAPMQGTAADLIKMAMVAVQDWLDA 845
gi 161521363 779 RYFARYPGVAQYMEDTRATAKERGYVETVFGRRLWLPEINGGNGPRRQAAERAAINAPMQGTAADLIKLSMIAVDGWLTR 858
gi 91777303  775 RYFARYPGVARYMDETRVSAKAKGYVETVFGRRLWLPEINGGNGPRRQAAERAAINAPMQGTAADLIKLSMIAVQKWIEE 854
gi 107026837 779 RYFARYPGVAQYMEDTRATAKEKGYVETVFGRRLWLPEINGGNGPRRQAAERAAINAPMQGTAADLIKLSMIAVDGWLTR 858
gi 116691969 779 RYFARYPGVAQYMEDTRATAKEKGYVETVFGRRLWLPEINGGNGPRRQAAERAAINAPMQGTAADLIKLSMIAVDGWLTR 858
gi 113868699 800 RYFMRYPGVAHYMEETRQTAREQGYVETVFGRRLWLPDINGGSGPRRQAAERAAINAPMQGTAADLIKLSMIAVQGWLER 879
gi 94311560  796 RYFMRYPGVAHYMEQTRQTAREQGYVETVFGRRLWLPDINGGNGPRRQAAERAAINAPMQGTAADLIKLSMIAVQDWLEG 875
                        890       900       910       920       930
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 73540576  883 DKLQTRQIMQVHDELVLEVPQDELDVVKTRLPELMCSVAQLRVPLVAEVGSGANWEEAH 941
gi 33602215  846 ERLRTRMIMQVHDELVLEVPDEELAAVAEALPRLMCDVATLRVPLVAEVGMGTNWEQAH 904
gi 33596490  846 ERLRTRMIMQVHDELVLEVPDEELAAVAEALPRLMCDVATLRVPLVAEVGMGTNWEQAH 904
gi 33592382  846 ERLRTRMIMQVHDELVLEVPDEELAAVAEALPRLMCDVATLRVPLVAEVGMGTNWEQAH 904
gi 161521363 859 DKLASRMIMQVHDELVLEVPDDELSLVREKLPEMMCGVAKLKVPLVAEVGAGANWEEAH 917
gi 91777303  855 SKIGTRMIMQVHDELILEVPDAELSDVRKRLPELMCGVADLKVPLVAEVGAGLNWEEAH 913
gi 107026837 859 DQLASRMIMQVHDELVLEVPEGELSLVREKLPEMMCGVAKLKVPLVAEVGAGANWEEAH 917
gi 116691969 859 DQLASRMIMQVHDELVLEVPEGELSLVREKLPEMMCGVAKLKVPLVAEVGAGANWEEAH 917
gi 113868699 880 DGLQTRQIMQVHDELVLEVPEHELELVKVRLPELMCSVAQLRVPLVAEVGSGANWEEAH 938
gi 94311560  876 ERLGTRQIMQVHDELVLEVPQAELELVRVKLPELMCAVATLNVPLVAEVGSGANWEEAH 934
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap