Conserved Protein Domain Family
PRK07598

?
PRK07598: PRK07598 
RNA polymerase sigma factor SigC; Validated
Statistics
?
PSSM-Id: 236067
View PSSM: PRK07598
Aligned: 11 rows
Threshold Bit Score: 554.865
Threshold Setting Gi: 37523331
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 298490007   9 DTAYDSPRSnpk-----lepDLGIDDgdFSLDDLQDLDIAAAvDSHNLAANTNRRSTDLVRLYLQEIGRVRLLGRDEEVS 83
gi 86606677    1 MSNYEPELN-----------DILLDG--DLLDPAEEAEVDLA-ESEFAEEEPARRSTDLVRLYLQEIGRVPLLGRDEEVA 66
gi 86610159    1 MSNYEPELN-----------DILLDGpaDLLEAAEEAEVDLA-DGEFLEEEPTRRSTDLVRLYLQEIGRVPLLGRDEEVA 68
gi 81300658    9 STEYEAVSS-----------------------DVANLSETPS-SEAVETAVSSRQSTDLIRLYLQDIGRVRLLGRDEEVS 64
gi 56752254    9 STEYEAVSS-----------------------DVANLSETPS-SEAVETAVSSRQSTDLIRLYLQDIGRVRLLGRDEEVS 64
gi 16331621    1 --MTKPSNDeppltnvrdleAMLPLEeeDLTADSQDLEYTAV-------AHRQQFSTDLVRLYLQDIGRIPLLKRDEEVH 71
gi 75907387    9 DAAYNTQKSrqa-----ldpDIAIDDsdLSVDEIQELEIAAA-DPATFGASANRRSTDLVRLYLQEIGRVRLLGRDEEVS 82
gi 17229184    9 DAAYNTQKSrqa-----ldpDIAIDDsdLSVDEIQELEIAAA-DPATFGASANRRSTDLVRLYLQEIGRVRLLGRDEEVS 82
gi 186681474   9 DAPYNTKKSrqa-----ldsDLTVDEseLSVDDLQELEIASV-DNANFAASTNRRSTDLVRLYLQEIGRVRLLGRDEEVS 82
gi 37523331    1 --------mhivdidrmatpDELEGGpdPVLDPQTLEAFVQV-DITDERPARPGSSTDLVRVYLQEIGRVPLLGRDEEVE 71
gi 158335266  12 HAVYDGQGNsrdldqnsnepEEVEFDpnADLDDDASEDLAAL-KMTPISAANRRGTTDLVRLYLQEIGRVSLLERDEEVA 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 298490007  84 EAQKVQRYLRlrivlanaakqgdtvivpyqrLIEVQERLSSELGHRPSLERWAKTAGidladlkptllegkrRWAEIAKL 163
gi 86606677   67 LAQRVQDYMK---------------------LLDVRLRLQKELGREPTLAEWAARAN---------------QYPEWANL 110
gi 86610159   69 LAQKVQDYMK---------------------LLDLRLRLQKELGRDPTLAEWVAKAN---------------QYPEWAQL 112
gi 81300658   65 EARWVQRYMQllavrncvaveeggvlkdyvdLQEGRDRLTAQLGHRPSFEAWAKIVDcsltelrqalqlglhRWAEVCQL 144
gi 56752254   65 EARWVQRYMQllavrncvaveeggvlkdyvdLQEGRDRLTAQLGHRPSFEAWAKIVDcsltelrqalqlglhRWAEVCQL 144
gi 16331621   72 IAQQVQSYLRlveiqnraae-sdaaidqyqtAIAVHDQLLVQLGHRPSYERWAKILGqtvatlkqtlksgkkRWAELAGL 150
gi 75907387   83 EAQKVQRYLKlrvvlanaakqgdevatpylhLIEVQERLASELGHRPSLERWAATAGinlcdlkpilsegkrRWAEIAKM 162
gi 17229184   83 EAQKVQRYLKlrivlanavkqgdevatpylhLIEVQERLASELGHRPSLERWAATAGinlcdlkpilsegkrRWAEIAKM 162
gi 186681474  83 EAQKVQRYLRmrivlanaaklgdeviipylrLVEVQERLTSELGHRPSLERWAATADivlsdlrptlangkrRWAEIAKL 162
gi 37523331   72 LAQQVQKLMK---------------------LTALKESLQTSLGSEYSDEQWA----------------------EAAKV 108
gi 158335266  91 EAQKVQRYMHlletreefle-shpviaeyarLTDVRDRLTAMLGHRPSFNRWAKEADipvadlkprlaegktAWAEKAEL 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 298490007 164 KVEELENVQSQGLQAKEHMIKANLRLVVSVAKKYQNRGLELLDLVQEGTLGLERAVEKFDPTKGYRFSTYAYWWIRQGIT 243
gi 86606677  111 TPEKLQQIQRIGKRAKEHMIKANLRLVVSVAKKYQNRGLELLDLIQEGTLGLERAVEKFDPKKGYRFSTYAYWWIRQGIT 190
gi 86610159  113 TPEKLQQIQRIGKRAKEHMIKANLRLVVSVAKKYQNRGLELLDLIQEGTLGLERAVEKFDPKKGYRFSTYAYWWIRQGIT 192
gi 81300658  145 DLEELKQVCKEGQRAKDHMIKANLRLVVSVAKKYQNRGLELLDLVQEGTLGLERAVEKFDPTKGYRFSTYAYWWIRQGIT 224
gi 56752254  145 DLEELKQVCKEGQRAKDHMIKANLRLVVSVAKKYQNRGLELLDLVQEGTLGLERAVEKFDPTKGYRFSTYAYWWIRQGIT 224
gi 16331621  151 TVEELENIEKQGITAKAHMIKANLRLVVSVAKKYQNRGLELLDLIQEGTLGLERAVEKFDPTKGYRFSTYSYWWIRQGIT 230
gi 75907387  163 TVEELEKMQSQGLQSKEHMIKANLRLVVSVAKKYQNRGLELLDLVQEGTLGLERAVEKFDPTKGYRFSTYAYWWIRQGIT 242
gi 17229184  163 TVEELEKMQSQGLQSKEHMIKANLRLVVSVAKKYQNRGLELLDLVQEGTLGLERAVEKFDPTKGYRFSTYAYWWIRQGIT 242
gi 186681474 163 TVEELEQVQSQGLQAKEHMIKANLRLVVSVAKKYQNRGLELLDLVQEGTLGLERAVEKFDPTKGYRFSTYAYWWIRQGIT 242
gi 37523331  109 GLFELKRQVLAGSRAKKKMIEANLRLVVSVAKKYQNRGLELLDLVQEGTLGLERAVEKFDPTKGYRFSTYAYWWIRQGIT 188
gi 158335266 170 SNAELDQIVKQGIKAKEHMIQANLRLVVSVAKKYQNRGLELLDLIQEGTLGLERAVEKFDPTKGYRFSTYAYWWIRQGIT 249
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 298490007 244 RAIATSSRTIRLPVHITEKLNKIKKAQRKISQEKGRTPTLEDLAIELDMTPTQVREVLLRVPRSVSLETKVGKDKDTELG 323
gi 86606677  191 RAIATQSRTIRLPVHITEKLNKIKKAQRKLSQEKGRTPTIEDIASELEMTVPQVRELLVRVPRSVSLETKVGKDKDTELG 270
gi 86610159  193 RAIATQSRTIRLPVHITEKLNKIKKAQRKLSQEKGRTPTIEDIASELEMTPPQVRELLVRVPRSVSLETKVGKDKDTELG 272
gi 81300658  225 RAIATQSRTIRLPVHVTEKLNRIKKAQRKIAQTKGRTANLEEIAQELEMTPDQVREVLLRVPKSISLETRVGKEKDTELG 304
gi 56752254  225 RAIATQSRTIRLPVHVTEKLNRIKKAQRKIAQTKGRTANLEEIAQELEMTPDQVREVLLRVPKSISLETRVGKEKDTELG 304
gi 16331621  231 RAIATQSRMIRLPVHITEKLNKIKRAQRKISQEKGHTPKIDEVAEELGMTPEQVREVLTQVPRSVSLELKVGQDKDTELM 310
gi 75907387  243 RAIATSSRTIRLPVHITEKLNKIKKAQRKIAQEKGRTPTLEDLAIELDMTPTQVREVLLRVPRSVSLETKVGKDKDTELG 322
gi 17229184  243 RAIATSSRTIRLPVHITEKLNKIKKAQRKIAQEKGRTPTLEDLAIELDMTPTQVREVLLRVPRSVSLETKVGKDKDTELG 322
gi 186681474 243 RAIATSSRTIRLPVHITEKLNKIKKAQRKIAQEKGRTPTLEDLATELEMTPTQVREVLLRVPRSVSLETKVGKDKDTELG 322
gi 37523331  189 RAIATQSRTIRLPVHITEKLNRIKKTQRKLSQNLGRTPTISEIAEELEMEPAHVRELMSRVPRSVSLETRVGKDKDTELG 268
gi 158335266 250 RAIATQSRTIRLPVHITEKLNKIKKAQRKLSQSKGRTASIEDIAQEMDMTPEQIRELLVRVPRSVSLEIKVGKDKDTELG 329
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 298490007 324 ELLETDSITPEEMLMRESLQKDLHHLLADLTSRERDVILMRFGLSDGHPYSLAEIGRALDLSRERVRQIESKALQKLRQP 403
gi 86606677  271 DLLETDDISPEETMMREALHRDLQQLLADLTSRERDVIRMRFGLGDGRTYSLAEIGRALDLSRERVRQIEAKALQKLRQP 350
gi 86610159  273 DLLETDDISPEETMMREALHRDLQQLLSDLTSRERDVIRMRFGLGDGRTYSLAEIGRALDLSRERVRQIEAKALQKLRQP 352
gi 81300658  305 DLLETTDFTPEERLTQESLSNDLQRLLLELNHRERDVIRMRFGLRDGQIYSLAEIGQVLDLSRERVRQIEAKALQKLRHP 384
gi 56752254  305 DLLETTDFTPEERLTQESLSNDLQRLLLELNHRERDVIRMRFGLRDGQIYSLAEIGQVLDLSRERVRQIEAKALQKLRHP 384
gi 16331621  311 DLLETDTQSPEDELMREALQNDMQEILLDLTPREQEVIALRFGFQDGVAHSLSEIGRILNLSRERVRQIEAKALQKLRHP 390
gi 75907387  323 ELLETDGVTPEEMLMRESLQRDLQHLLADLTSRERDVILMRFGLADGHPYSLAEIGRALDLSRERVRQIESKALQKLRQP 402
gi 17229184  323 ELLETDGVTPEEMLMRESLQRDLQHLLADLTSRERDVILMRFGLADGHPYSLAEIGRALDLSRERVRQIESKALQKLRQP 402
gi 186681474 323 ELLETDCVTPEEMLMRESLQRDLHHLLSDLTSRERDVILMRFGLADGHPYSLAEIGRALDLSRERVRQIESKALQKLRQP 402
gi 37523331  269 ELLEAEEVSPEESAVQESLRRDVKELLDDLTLRERDVITMRYGLLDGRTYSLSEIGRALDLSRERVRQIESKALQKLRQP 348
gi 158335266 330 DLLETDDISPEELIMRESLQQELKQLLADLTPRERDVITMRFGLNDGKTHSLAQIGKSLDLSRERVRQIESKALQKLRQP 409
                        410
                 ....*....|....
gi 298490007 404 KRRNLIRDYLESLS 417
gi 86606677  351 KRRNRVRDYLEAIS 364
gi 86610159  353 KRRNRVRDYLEAIS 366
gi 81300658  385 RRRNQIRDYLELLH 398
gi 56752254  385 RRRNQIRDYLELLH 398
gi 16331621  391 RRRDRIRDYYENLG 404
gi 75907387  403 KRRNLIRDYLESLS 416
gi 17229184  403 KRRNLIRDYLESLS 416
gi 186681474 403 KRRNLIRDYLESLS 416
gi 37523331  349 RRRAKVRDYLELME 362
gi 158335266 410 KRRNRIRDFLEAFA 423
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap