Conserved Protein Domain Family
PRK07560

?
PRK07560: PRK07560 
elongation factor EF-2; Reviewed
Links
?
Statistics
?
PSSM-Id: 236047
View PSSM: PRK07560
Aligned: 88 rows
Threshold Bit Score: 1171.95
Threshold Setting Gi: 161528256
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156938170   1 MPKYKHVEDILKIMRNVEQVRNIGIIAHVDHGKTTTSDALLAHAGILSPKLAGEARALDYLDVEQQRGITVKAANVSLYH 80
gi 119719525   1 MVRYKQVSDIVKIMRNVEQVRNIGTLAHVDHGKTTTSDSLLMGAGILSPKAAGQALALDYVEIEQLRQMTVKAANVSLYH 80
gi 119873440   6 RIVEKQLDEILAIARNPAQIRNAGTLAHVDHGKTTTTDSLLMGAGLLSPKVAGKALAMDYVPIEQLRQMTVKAANISLYF 85
gi 18311871    6 RIVEKQLDEILAIAKNPAQIRNAGTLAHVDHGKTTTSDSLLMGAGLLSPKVAGKALAMDYVPIEQLRQMTVKAANISLYF 85
gi 146302869   1 MPKYKTSEQVLSLMKDRTRVRNIGIIAHVDHGKTTTSDQLLAASGIISPKVAGEALALDYLSVEQQRGITVKAANVSLYH 80
gi 171185548   6 RVVEKQLDEILAIARNPAQIRNAGTLAHVDHGKTTTSDSLLMGAGLLSPKVAGKALAMDYVPIEQLRQMTVKAANISLYF 85
gi 159041508   4 RVVEKRIEDILEIMRNPSQIRNVGTLAHVDHGKTTTTDSLLMGAGLLSPKVAGKALALDYVEIEQIRQMTVKAANISLYF 83
gi 145592335   6 RIVEKQLDEILAIARNPAQIRNAGTLAHVDHGKTTTTDSLLMGAGLLSPKVAGKALAMDFVAIEQLRQMTVKAANISLYF 85
gi 126458838   6 RIVEKQLDEILAIARNPAQIRNAGTLAHVDHGKTTTTDSLLMGAGLLSPKVAGKALAMDYVPIEQLRQMTVKAANISLYF 85
gi 170289744   2 QKYKKVIDHLQELMRDPRNIRNIGIIAHVDHGKTTLSDNLLSAAGMISDKMAGEMRALDYHEIEQQRGITIKAANISLYY 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156938170  81 EYKGKPYVINLIDTPGHVDFSGKVTRSLRVLDGAILVVDAVEGVMTQTETVLRQALEELVRPLLFINKVDRLIKELKLSP 160
gi 119719525  81 EWEGKPYVINLVDTPGHVDFTGHVTRSLRMMDGGIVVVDAVEGVMTQTETVVRQALSEYVRPLLYINKVDRLIKELRLEP 160
gi 119873440  86 EYGGKPYLINFVDTPGHVDFTGHVTRSLRVMDGGLVVVDAVEGVMTQTETVVRQALEEYVRPVLFINKIDRLIKELRLSP 165
gi 18311871   86 EYGGKPYLINFVDTPGHVDFTGHVTRSLRVMDGGLVVVDAVEGVMTQTETVVRQALEEYVRPVLFINKIDRLIKELRLSP 165
gi 146302869  81 EVEGKGYVINLIDTPGHVDFSGRVTRSLRVLDGSIVVVDSVEGVMTQTETVLRQSLEERVRPILFVNKVDRLVKELKLGP 160
gi 171185548  86 EYGGKPYLINFVDTPGHVDFTGHVTRSLRVMDGGLVVVDAVEGVMTQTETVVRQALEEYVRPVLFINKIDRLIKELRLSP 165
gi 159041508  84 EYGGKPYLINFVDTPGHVDFTGHVTRSLRVMDGALVVVDAVEGVMTQTETVVKQAMEEMVRPVLFINKIDRLIKELRLPP 163
gi 145592335  86 EYGGKPYLVNFVDTPGHVDFTGHVTRSLRVMDGGLVVVDSVEGVMTQTETVVRQALEEYVRPVLFINKIDRLIKELRLSP 165
gi 126458838  86 EYGGKPYLINFVDTPGHVDFTGHVTRSLRVMDGGLVVVDAVEGVMTQTETVVRQALEEYVRPVLFINKIDRLIKELRLSP 165
gi 170289744  82 QRDGKEFAINLVDTPGHIDFTGHVTRSLRVIDGAIVVVDSVEEVMVQTETVTRQALEERVRPLLFINKIDRLIKELKLTP 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156938170 161 QEIQQRIVQIIKDVNERILTFApDPEIAKKWLLDPAKGHVALGSAKDKWGITIPMAQEKGIKFSDIVEAYakgSKDAIEE 240
gi 119719525 161 REIQQRFVEIVKEFNALIELYA-DKEFKDKWKVDFAKGQVAFGSALHKWGLTVPIATQKGVKFDYIIDAY---LRDEKDK 236
gi 119873440 166 QEIQQRILTIVKDFNALIEMFA-PPEFKDKWKIDPGKGQMAMGSALHKWGITIPMAQKAGIKFSNIIDAY---EKGYVDQ 241
gi 18311871  166 QEIQQRILTIVKDFNALIDMFA-PPEFKDKWKIDPGKGQMALGSALHKWGITIPMAQKAGIKFSNIVDAY---EKGYVDQ 241
gi 146302869 161 QEMMQKLMDIIKEVNNLINIYA-EPELKEKWAINPTLGNVVFGSAKDRWGFSIPMAQKKGINMKHVIDAYsttDKTKINE 239
gi 171185548 166 QEIQQRILTIVKDFNALIDMFA-PPEFKDKWKVDPGKGQMAMGSALHKWGITIPMAQKAGIKFSNIVDAY---EKGYVDQ 241
gi 159041508 164 QDIGNRILYITKEFNSLIDSYA-PPEFKEKWKVSVNKGQVAFGSALSKWGLTIPMMQEKGIKFSYIMDAY---ERNAVDE 239
gi 145592335 166 QEIQQRILTIVKDFNALIDMFA-PPEFKDKWKVDPAKGQVALGSALHKWGITIPMAQKAGLKFSNIVDAY---EKGYVDK 241
gi 126458838 166 QEIQQRILSIVKDFNALIDMFA-PPEFKDKWKIDPGKGQMAMGSALHKWGITIPMAQKAGIKFSNIVDAY---EKGYVDK 241
gi 170289744 162 QEIQQKILRIIRDFNGLIEAYG-EPEFREKWKVKWDNDSVAFGSALHGWGLTNSIAAKKGIRFSDIVDIYn--EDPEGLA 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156938170 241 LFHKAPLHETLLDMVVRWVPNPREAQKYRVPRLWKGDINSELGKAMLNCDPEGPLVVFINDMRLDPHTKrLVATGRVWAG 320
gi 119719525 237 LAEEFPLYVALLDMVVEHIPNPREAQKYRVPKLWKGDLNSEIGKAMLECDPDGPTVVAVSKITVDPHAG-HVATGRVFSG 315
gi 119873440 242 LAQEFPLYKTLLSMIIEHVPPPNVAQKYRIPRLWRGDLNSEVGKALLEADPNGPTVIAVSKVNKDPHAG-LIVTGRVFSG 320
gi 18311871  242 LAQEFPLYKTILSMIIEHIPPPNVAQKYRIPRLWRGELNSEVGKALLEADPNGPTVIAVSKVNKDPHAG-LIATGRVFSG 320
gi 146302869 240 LASQVPINEALLDAVIKFVPNPVDAQKYRIPKIWKGDLDNELAKSMLNADPNGPVVMMITDMKVDPHAG-LVATGRVFSG 318
gi 171185548 242 LAQEFPLYKTLLTMIIEHVPPPNVAQKYRIPRLWRGDLNSEIGKALLEADPNGPTVIAVSKVNKDPHAG-LIATGRVFSG 320
gi 159041508 240 LAQEFPLYRTLLTMIIEHIPPPDVAQKYRVPKLWKGDLNSPVGKALLDADPNGPLVIAISKINKDPHAG-LIATGRVFSG 318
gi 145592335 242 LGEEFPLYKTLLTMIIEHVPPPNVAQKYRIPRLWRGDLNSEVGKAMLEADPNGPTVIAVSKVNKDPHAG-LIATGRVFSG 320
gi 126458838 242 LAEEFPLYKTLLTMIIEHVPPPNVAQKYRIPRLWRGDLNSEVGKALLEADPNGPTVIAVSKVNKDPHAG-LIATGRVFSG 320
gi 170289744 239 LRRDIPVHEALLDMVALHVPDPIEAQSYRVERLWRDKQDEELFNALKNCDPNGPLIMGVNAVRIDPHAG-IVVTGRVFSG 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156938170 321 TATAGKEVWLVNAQKPGKILQVSIYMGPDREIVDYVTAGNIVAMLGLDDARAGETLVDINykdQAAP--FEQLHYVSEPV 398
gi 119719525 316 TVTEGQEVYLLNAKDSAKVLQVGLYMGPYREKTEQISAGNIVAMLGLDKARAGETVVDIKykdVMTP--FEHLAYVAEPV 393
gi 119873440 321 TIREGDEIYIIGRKMKKKVLQTYIYMGPSRIIVPYMPAGNIVALMGVDEARAGDTLVDPRi-sDIPP--FEKMRYIAEPV 397
gi 18311871  321 TIREGDEVYIIGRRLKKKVLQTYIYMGPSRIIVPYMPAGNIVALMGVDEARAGDTLVDPKf-sEIPP--FEKMRYISEPV 397
gi 146302869 319 TIRPGSEVWLVNAKAPQKVLQVSIYMGQFRELADEIPAGNIAAVLGLERARSGETLIDIRy--KDLQgsFEKLHYVSEPV 396
gi 171185548 321 TIREGDEIYIIGRKMKKKVLQTYIYMGPSRIIVPYMPAGNIVALMGVDEARAGDTLVDPRl-sEIPP--FEKMRYISEPV 397
gi 159041508 319 TIREGDEVYIIGQKITKKVLQTYLYMGPNRIIVPEVTAGNIVALMGVDEARAGDTLVATAl-kDIPP--FEKMRYVSEPV 395
gi 145592335 321 TIREGDEVYIIGRKMKKKVLQTYIYMGPTRIIVPYMPAGNIVALMGVDEARAGDTLVDPRl-tEVPP--FEKMRYIAEPV 397
gi 126458838 321 TIREGDEIYIIGRKMKKKVLQTYIYMGPTRIIVPYMPAGNIVALMGVDEARAGDTLVTPSl-aDIPP--FERMRYISEPV 397
gi 170289744 318 TLREGEDVYLINAKKKQKIQQTSIYMGPYRMRMDEIPAGNIAAVLGLTSASSGETVVADAi-kDRVIsgFEAIRYVTEPV 396
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156938170 399 VTVAIEPKNPRDLPKLIEALRTLSIEDPNLKVTINQETGEYLLSGMGMLHIEIALTQLkEVYGLEVKVSPPVITYRETVR 478
gi 119719525 394 VTIAVEPKKSSDLPKLVDVLRKLAIEDPTLKVYINQETGEYLLSGVGTLHLEITLWELkQRTGIEIVTSPPIVRYRETVR 473
gi 119873440 398 VTVAIEPKNPAELAKLVEALKDLVIEDPTLDLKIDQETGQILLSGVGTLHLEIATWLLkERSKTEFTVSPPLIRFRETVR 477
gi 18311871  398 VTVAIEPKNPAELARLVEALKDLVVEDPTLDLKIDQETGQILLSGVGTLHLEIATWLLkERTKTEFTVSPPLIRFRETVR 477
gi 146302869 397 VTIAVEPKNPKDLTKMIDALRKLSIEDPNLVVKINEETGEYLLSGMGFLHVEVSLQLLkDNYGVDVVTTPPIVVYRESVR 476
gi 171185548 398 VTVAIEPKNPAELARLVEALKDLVIEDPTLDLKIDQETGQILLSGVGTLHLEIATWLLkERTKTEFTVSPPLIRFRETVR 477
gi 159041508 396 VTVAIEPKNPNDLAKLVEGLRDLVIEDPTLSLKIDEETGQILLSGVGTLHLEIATWLLkDRTGLDFVVSQPLVRFRETVR 475
gi 145592335 398 VTVAIEPKNPAELAKLVEALKDLVIEDPTLDLKIDQETGQILLSGVGTLHLEIATWLLkERAKTEFTVSPPLIRFRETVR 477
gi 126458838 398 VTVAIEPKNPAELARLVEALKDLVIEDPTLDLKIDQETGQILLSGVGTLHLEIATWLLkERTKVEFSVSPPLIRFRETVR 477
gi 170289744 397 VTVSVEAKNPQDLPKLIDTLRKLTLQDPNLVMIHNQETGEILLKGTGELHLEISLYEV-RKAGLEFDVSEPTVVYRESVR 475
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156938170 479 KPGEKVEGKSPNKHNKLYITVEPLEKEVIEMIQKGEITDDQDPRErakVLRDKVNWDADTARRIWAVdeENFNIFIDKTV 558
gi 119719525 474 EKGQVFEGKSPNKHNKLYFYVEPLNEETIKLMQEGKVYPDQDWREratLLREYAGWDTDEARNIWDId-ENFNVIVNKTS 552
gi 119873440 478 ERSQVWEGKSPNKHNRLYFYVEPLDETTIELIATKEITEDQDPRErakILREKAGWDTDEARGIWAIddRYFNVIVDKTS 557
gi 18311871  478 ERSQVWEGKSPNKHNRLYFYVEPLDETTIELIASREITEDQEPRErakILREKAGWDTDEARGIWAIddRYFNVIVDKTS 557
gi 146302869 477 NKSQVFEGKSPNKHNKFYISVEPLNDKTIELISNGTIKEDMDSKEmakILRDQADWDYDEAKKIIAId-ENVNVLIDATS 555
gi 171185548 478 ERSQVWEGKSPNKHNRLYFYVEPLDETTIELIATREITEDQDPRErakILREKAGWDADEARGIWAIddRFFNLIVDRTS 557
gi 159041508 476 ARSQVFEGKSPNKHNRLYISVEPLDEESISLIQYSEVTEDMDPRErarILREKANWDTDEARGIWAIdnQYINVLIDKTS 555
gi 145592335 478 ERSQVWEGKSPNKHNKLYFYVEPLDETTVELIATKEITEEQDPRErakILREKAGWDTDEARGIWAIddRYFNVIVDKTT 557
gi 126458838 478 ERSQVWEGKSPNKHNRLYFYVEPLDETTVELIATREITEEQDPRErakILREKAGWDTDEARGVWAIddRYFNVIVDKTT 557
gi 170289744 476 GTSDVVLAKSPNKLNRIWVTASPLNDEVVALIREGRVNERMDSRTlakVLREEGKMDTEDARNVWTIdeENYNLFINRTV 555
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156938170 559 GVQHLREVKDTILAGWRLAMKEGPLAKEPVRGVKVILWDAVIHEDPAHRGPAQLYPAVRNAVYASMLTDSPTLLEPWQKL 638
gi 119719525 553 GIQYLREVKDTIIQGFRWTMEAGPLAQEPVRGVKVVLVDAVLHEDPAHRGPAQIMPATKNSIMASLLSAKPTLLEPILKV 632
gi 119873440 558 GIQYLREIRDYIVQGFRWATEAGPLAQEPIRGVKVVLVDAVVHEDPAHRGPAQIMPATKNAIFAAMLSAKPTVLEPLLRL 637
gi 18311871  558 GIQYLREIRDYIVQGFRWSMEAGPLAQEPMRGVKVVLVDAVVHEDPAHRGPAQIMPATKNAIFAAVLSARPTLLEPLMRL 637
gi 146302869 556 GVQHLREIMDTMLQGYRLAMREGPLAHEPIRGVKVILHDATIHEDPAHRGPAQIYPAVRNAIFAAMLMSKPTLLEPLQKL 635
gi 171185548 558 GIQYLREIRDYIVQGFRWATEAGPLAQEPMRGLKVVLTDAVVHEDPAHRGPAQIMPATKNAIFAAVLSARPTILEPLMKL 637
gi 159041508 556 GIQHLREIRDYIVQGFRWSMSAGPLAQEPIRGVKVILHDAVVHEDPAHRGPAQIMPATKNAIFASFLSANPTLLEPLLLI 635
gi 145592335 558 GIQYLREIRDYIVQGFRWAMEAGPLAQEPMRGVKVVLVDAVVHEDPAHRGPAQIMPATKNAIFAAVLSARPTLLEPLVRL 637
gi 126458838 558 GIQYLREIRDYIIQGFRWAMEAGPLAQEPIRGVKVVLVDAVVHEDPAHRGPAQIMPATKNAIFAAFLSARPTILEPLVRL 637
gi 170289744 556 GVQRLDEVREILRQGFMWVMKEGPLAGEPVMGVAIRLVNAMIHEDPAHRGPAQLTPAVRKAIFGAMLSANPVLLEPIYEI 635
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156938170 639 DIRVPNEYIGAVTGVITKHRGKILEVID-MGGQARIVAAVPIAESF-ELPMELRSVTAGRAFWGTEFYGWEPVPDQLLPE 716
gi 119719525 633 DVKVPTQHVSGVLTVLNRHRGRILSMEE-RGMVMRVLAELPVAESF-NIADEMREATQGRAFFAYEFYKWAPVPSSQLEQ 710
gi 119873440 638 DIKVAPDYIGAVTSVLNKHRGKILDMTQ-QEYMAYLRAELPVLESF-TISDELRAAAAGKIFWSMQFSRWAPVPESMLLD 715
gi 18311871  638 DIKVAPDYIGAVTSVLNKHRGKILDMTQ-QEYMAFLRAELPVLESF-NISDELRAAAAGKIFWSMQFARWAPFPESMLGD 715
gi 146302869 636 DIRVPMEFVGNVTAVLSRKRGKVLNMTQ-SGSVARILAEIPVSESY-ELASDLRGSTGGRAFWGTEFSKWAPVPDSILTD 713
gi 171185548 638 DIKVAPDYIGAVTSVLNKHRGKILDMTQ-QEYMAYLRAELPVLESF-TISDELRAAAAGKIFWSMQFSRWAPMPESILAD 715
gi 159041508 636 DAKTTVDNMGPVTSVITRHRGRVIDVTQtETMEVIVKGEIPVIESF-NISDELRSATTGRVFWSLQFSRWAPVPESLRES 714
gi 145592335 638 DIKVAPDYIGSVTSVLNKHRGKILDMTQ-QEYMAYLRAELPVLESF-TISDELRAAAAGKIFWSMQFARWAPYPESMLVD 715
gi 126458838 638 DIKVAPDYIGAVTSVINKHRGKILDMTQ-QEYMAFLRAELPVLESF-TISDELRAAAAGKIFWSMQFSRWAPYPESMLAD 715
gi 170289744 636 QVSTPPELIGSVISLISQKRGKVVGIEE-RGRISIVKGFIPVRETLgGFSNEMRSMTSGRAFWQTKFSHWEPLPKSLMEQ 714
                        730       740
                 ....*....|....*....|...
gi 156938170 717 LIRKIRERKGLPPEPPKAEDFLG 739
gi 119719525 711 IALAIRERKGLPKKLPTIEEFLG 733
gi 119873440 716 LVKQLRKKKGLKEEIPKPTDFVE 738
gi 18311871  716 FVKQLRKKKGLKEEIPKPTDFVE 738
gi 146302869 714 VILKIRERKGLPKELPKVEDFLS 736
gi 171185548 716 MVKQLRKKKGLKEEIPKPTDFVE 738
gi 159041508 715 LILSIREKKGLPKELPKIEDYIS 737
gi 145592335 716 FVKQLRKKKGLKEDIPKPTDFVE 738
gi 126458838 716 FVKQLRKKKGLKEEIPKPTDFVE 738
gi 170289744 715 VALEIRRRKGMKEELPKAEEYMD 737
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap