Conserved Protein Domain Family
PRK07556

?
PRK07556: PRK07556 (this model, PSSM-Id:102944 is obsolete)
DNA polymerase I; Provisional
Statistics
?
PSSM-Id: 102944
View PSSM: PRK07556
Aligned: 40 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91975436    26 PGKGDHIFLVDGSSYIFRAYHALPPLSRKSDGLQVNAVLGFCNMLWKLLRDMPPDNRPTHLAIIFDKSEATFRNEMYPAY 105
gi 167644193   27 DGPTVRLFLVDGSAYLFRAYHALPPLTRKSDGLPVGAVQGFCNMLWKLMRDMQGD-APTHLAVIWDHSEKTFRNNLYDKY 105
gi 159045449    3 FGKGHHLHLIDGSAFIFRAYHALPPLTRKSDGLPVGAVSGFCNMLQRYVEGNAGGD-VTHVAVIFDKGSHTFRNDLYDQY 81
gi 89054174     3 FGKGHHLHLVDGSAFIFRAYHALPPLTRKSDGLPIGAVAGFCNMLHKMIEGNTGPDAPTHAAVIFDKGSHTFRNDLYDQY 82
gi 77464609     3 FGKGHHLHLIDGSAFIFRAYHALPPLTRKSDGLPVGAVAGFCNMLFRYVENNKGPDAPTHVAVIFDHSSKTFRNEIYPLY 82
gi 146276256    3 FGKGHHLHLIDGSAFIFRAYHALPPLTRKSDGLPVGAVAGFCNMLFRYVENNKGPDAPTHVAVIFDHSSKTFRNEIYPLY 82
gi 126463449    3 FGKGHHLHLIDGSAFIFRAYHALPPLTRKSDGLPVGAVAGFCNMLFRYVENNKGPDAPTHVAVIFDHSSKTFRNEIYPLY 82
gi 110677750    5 FGKGHHLHLIDGSAFIFRAYHALPPLTRKSDGLPIGAVSGFCNMLHRYVEGNTGPDAPTHVAVIFDKGSHTFRNDMYDLY 84
gi 56698655     4 FGKGCHLHLIDGSAFIFRAYHALPPLTRKSDGLPIGAVSGFCNMLQRYVDGDHGPDAPTHLAVIFDKGSHTFRNDLYDLY 83
gi 99082604     6 FGKGCHLHLIDGSAFIFRAYHALPPLTRKSDGLPIGAVSGFCNMLFKQVEDNKGPDAPTHVAVIFDHSGKSFRNDMYDQY 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91975436   106 KAHRPPAPDDLIPQFALIREAVRAFDLPCLEQSGFEADDLIATYVREACEAGATATIVSSDKDLMQLVTDCVTMYDTMKD 185
gi 167644193  106 KAHRPPPPEDLIPQFPLVREATRAFGVPAIELPGYEADDLIAAYACKVRDMGGEAVIVSSDKDLMQLVGDGVSMFDPMKG 185
gi 159045449   82 KANREAMPEDLRPQIPLTRTATEAFNIACKEMEGFEADDIIATLACQAREAGGRCTIISSDKDLMQLVGGGVEMLDAMKN 161
gi 89054174    83 KANRDAMPEDLRPQIPLTRDATRAFNLACIEMEGFEADDIIATYARMAREAGGRCTIISSDKDMMQLVGDGVEMFDAMKN 162
gi 77464609    83 KAQRPEPPEDLRPQFPLTREATRAFNIACIETEGFEADDIIAALSCKARDAGGSVTILSSDKDLMQLVGDGVEMLDPMKN 162
gi 146276256   83 KAQRPEPPEDLRPQFPLTREATRAFNISCIETEGFEADDIIAALACRAREAGGTCTILSSDKDLMQLVGDGVEMLDPMKN 162
gi 126463449   83 KAQRPEPPEDLRPQFPLTREATRAFNIACIETEGFEADDIIAALSCKARDAGGSVTILSSDKDLMQLVGDGVEMLDPMKN 162
gi 110677750   85 KANRDAMPEDLRPQIPLTRRATEAFNIACKEKEGYEADDIIATLAVQARAAGGRCTIISSDKDLMQLVGDGVEMLDAMKN 164
gi 56698655    84 KANREAMPEDLRPQIPLTRAATEAFNIPCKELEGYEADDIIATLSNQARDAGGRVTIVSSDKDLMQLVGDGVEMFDAMKN 163
gi 99082604    86 KANRPPAPEDLVPQFPLTREATRAFNIACKEIEGFEADDIIATLACQAREAGGRVTIISSDKDLMQLVGDGVEMLDAMKN 165
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91975436   186 RRIGVAEVIEKFGVPPDKVVEVQALAGDSVDNVPGVPGIGIKTAAQLITEYGDLETLLARAGEIKQPKRREALIENAEKA 265
gi 167644193  186 LRIDRDQVFEKFGVYPDRVVDVQSLCGDSVDNVPGAPGIGIKTAAQLINEYGDLDTLLERAGEIKQPKRRETLIEYADQI 265
gi 159045449  162 KTIDVDGVFEKFGVGPDRVVDVQALAGDSVDNVPGAPGIGIKTAALLINEYGSLEELLDRAGEIKQPKRRQTLIEHRAQI 241
gi 89054174   163 TRIDREGVEAKFGVGPERVVDVQALAGDSVDNVPGAPGIGIKTAALLINEYGDLDALLDRAEEIKQPKRRQTLIDHADQI 242
gi 77464609   163 KRIGRDEVFEKFGVYPERVVDVQALAGDSIDNVPGAPGIGIKTAALLIQEYGDLESLLARAGEIKQPKRRAAIEENAEQI 242
gi 146276256  163 KRIGRDEVIEKFGVPPERVVDVQALAGDSVDNVPGAPGIGIKTAALLIQEYGDLEGLLARAGEIKQPKRRAAIEDNAEQI 242
gi 126463449  163 KRIGRDEVFEKFGVYPERVVDVQALAGDSIDNVPGAPGIGIKTAALLIQEYGDLESLLARAGEIKQPKRRAAIEENAEQI 242
gi 110677750  165 KRIDRDGVFEKFGVYPERVVDVQALAGDSVDNVPGAPGIGIKTAALLINEFGDLDALLERAAEIKQPKRRQTLIDHADQI 244
gi 56698655   164 KRIDRDGVFEKFGVFPDRVVDVQALAGDSVDNVPGAPGIGVKTAALLINEYGSLEDLLDRAEEIKQPKRRQTLIDMRAQI 243
gi 99082604   166 KRIDSDGVREKFGVGPDRVVDVQALAGDSVDNVPGAPGIGIKTAALLINEFGSLEDLLDRAEEIKQPKRRQTLIEKRDQI 245
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91975436   266 RISRKLVLLDDHVKLDVPLDELAVHEPDARKLISFLKAMEFTTLTRRVADYAQIDPSDVEAEAALkssplplagevgARS 345
gi 167644193  266 RLSRQLVKLDCDTPLPEPIDDLVVREPDKTVLADFLELMEFRSLARRVGDGNASASPR-------------------TLD 326
gi 159045449  242 ELSKRLVQLDCDMELDFTIEDLEVRDPEPETLLGFLAEMEFRTLTKRISGALGVEAPAV--------------------- 300
gi 89054174   243 RLSRQLVLLDENVELEDGLDALDVREPDHDTLLAFLAEMEFRTLTKRIADSAGVEAPVIE-------------------- 302
gi 77464609   243 RISKRLVALDCNTPLTFSLEDLEVRLPVADDLLGFLNRMEFRTLTTRVAASLKVEPPPAPTAAVL--------------- 307
gi 146276256  243 RISKRLVELDCNTPLDFALEDLEVRLPVADELLGFLNRMEFRTLTTRVAASLKVEPPPAPTAFVV--------------- 307
gi 126463449  243 RISKRLVALDCNTPLTFSLEDLEVRLPVADDLLGFLNRMEFRTLTTRVAASLKVEPPPAPTAAVL--------------- 307
gi 110677750  245 RLSRRLVLLDEATPLDFTLEDLEVRTPDPDQLMPFLAEMEFRTLTKRIADQLKVEMPEI--------------------- 303
gi 56698655   244 ELSKRLVELDANTPLDFTLDDLELRDPDPEKLLSFLAEMEFRTLTKRIADKLGAEAPVIA-------------------- 303
gi 99082604   246 EMSKRLVQLDCDMELDFTLDDLEVRDPDADTLLGFLAEMEFRTLSKRMADQLGREAPTIP-------------------- 305
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91975436   346 ATGGGTAASGDLFSEqvpstqpspasgrgsaqqsgeggalnagrgrdgrpgevlSPQILAARRAETARKIPVDRTAYKTI 425
gi 167644193  327 RPAAAPTAPVLGVSY---------------------------------------MGAAARAAANPVAEPATIDHAAYVRI 367
gi 159045449  301 ------------------------------------------------------PEPAATTASPEAEEHPPLSASEHVTI 326
gi 89054174   303 --------------------------------------------------------EPAPEAAPDAPEMPPIDHAKYEVV 326
gi 77464609   308 ------------------------------------------------------RNEGVPEIVEQVEAALPFDSASYACI 333
gi 146276256  308 ------------------------------------------------------QNESVPEIVEQVEAALPFDSASYACV 333
gi 126463449  308 ------------------------------------------------------RNEGVPEIVEQVEAALPFDSASYACV 333
gi 110677750  304 ------------------------------------------------------NDTPANAPAAPEIADVPFDKAGYSQV 329
gi 56698655   304 ------------------------------------------------------EKASPEAEEAPQPEQPPFDASRYECV 329
gi 99082604   306 ------------------------------------------------------EAPSAAAAALELPEAPGFDSAEYTTV 331
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91975436   426 RTLDELHGWIARIHDAGFVAVDAIATSIDPMQAELCGIALALAPNDAAYIPLGHRqTGDgSGLFAAG--LAPDQLGAREA 503
gi 167644193  368 QDLETLNAWVAKATAKGIVAFDTETDALSSATAGLCGVSLAISPGEACYIPVGHC-EKD-GLALEAA--ADLVQVPMEEV 443
gi 159045449  327 RDAETLQSWIDAIHARGVVAVDTETTGLNEMRADLVGVSLCVDPGRAAYLPLAHKdGGGaDDLFGGEakLAEGQLDFETA 406
gi 89054174   327 NDVKTLQAWVDRAVVRGEVAFDTETTSLNEMTAELVGVSLCIEPGAACYIPLLHR--GGgDDLFADTs-LAEGQIPFDDA 403
gi 77464609   334 RDAEALAAWIARIRDLGHVAIDTETTSLDEMRAELVGISLCVEAGAACYIPLGHR-AGG-GDLFGASe-LVADQMPLGLA 410
gi 146276256  334 RDAEALAAWIARIRERGHVAIDTETTSLDEMRAELVGISLCVEAGSACYIPLGHR-AGG-GDLFGSLd-LVADQIPLDLA 410
gi 126463449  334 RDAEALAAWIARIRDLGHVAIDTETTSLDEMRAELVGISLCVEAGAACYIPLGHR-AGG-GDLFGASe-LVADQMPLGLA 410
gi 110677750  330 DSAEALQGWIDQIYERGYVAVDTETTGLNEMTAELVGISLCVEPGTACYIPLIHKaAGS-DDLFGSDd-LAEGQMPLETA 407
gi 56698655   330 RDAAALETWIAQARERGWVAVDTETTSLNEMTADLVGISLAVEPGAACYIPLGHR-DGDaGDLFGSDk-LAEGQLPLQQT 407
gi 99082604   332 RDAETLQQWIDLIREHGYVAVDTETTGLNEMIADLVGISLCVVPGQACYVPLTHK-TGNsDDLFGSDd-LAEGQMPLKDA 409
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91975436   504 LDALKPLLESAGLAKIGFNIKFTAVLLAQHGITLRNIDDLQLMSYALDAGRGSHGLDALSESNLGHTLHALGELTGSGKA 583
gi 167644193  444 IAALKPLLEDPAVLKIAQNAKYDIAVLARYGINVGPIEDTMLISYVLEAGLHGHGMDELSELWLGHKPISFKQVAGSGKG 523
gi 159045449  407 LGMLKPVLEDPAVLKIGQNMKYDAKILARNGITVAPIDDTMLLSYALHAGLHGHGMDALSERYLDHTPIPIKTLLGTGKS 486
gi 89054174   404 MEILQPMLEDRSVMKVAQNAKYDVKVLANYGVEVAPIDDTMLLSYALHAGLHNHGMDGLAERYLGHTPLPIKSLIGSGKS 483
gi 77464609   411 LSMLKPVLEDESILKIGQNMKYDAKILARHGIRVAPIDDTMLMSYAMHAGRHGHGMDELCDTYLGHKPIAIKTLLGSGKS 490
gi 146276256  411 LSMLKPVLEDDAILKIGQNMKYDAKIFARHGIRVAPIDDTMLMSYAMHAGRHGHGMDELCDTYLGHKPIAIKTLLGSGKS 490
gi 126463449  411 LSMLKPVLEDESILKIGQNMKYDAKILARHGIRVAPIDDTMLMSYAMHAGRHGHGMDELCDTYLGHKPIAIKTLLGSGKS 490
gi 110677750  408 LEMLKPVLEDESILKIGQNMKYDAKVFAQVGITVAPIDDTMLMSYAMHGGLHGHGMDALSERYLGHTPLPIKPLLGSGKS 487
gi 56698655   408 LDLLKPMLEDPAILKIGQNMKYDAKIFARYGVAVAPIDDTMLLSYAMHGGLHGHGMDTLSERYLSHTPIPIKPLLGSGKS 487
gi 99082604   410 LEMLKPVLEDDAILKIGQNMKYDAKIFARNGIDVTPIDDTMLLSYALHGGMHGHGMDTLSERYLDHQPIPIKSLLGSGKS 489
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91975436   584 KIGFDQVPIERATEYAGERADVALRLWRVLKPRLVAERMMAVYETLERPLVGVLARMERRGISIDRSVLSRLSADFAQTA 663
gi 167644193  524 QISFKHVGLAEATAYAAEDADVTLRLYNVLKPRLAREGLLTVYETLERPLPAVLAAMENDGIRVDPDTLRRLSNEFSMRM 603
gi 159045449  487 AITFDFVPIEEATKYAAEDAEITLRLWQRLKPRLHLAQVTRVYEWMERPMVPVLAEMEMRGIKVDRDTLSRMSNAFAQKM 566
gi 89054174   484 QITFDRVPIADAAPYAAEDADITLRFHKLFKPKLHQVGVTKVYERLERPLVPVLARMERSGIKVDKDVLSRMSNAFAQKM 563
gi 77464609   491 QITFDRVPVEQAVCYAAEDADVTFRLWKLFKPQLHRARVTTVYETLERPLVPVLAEMEMAGVQVDRDTLSRMSNAFAQKM 570
gi 146276256  491 QITFDRVPVDQAVCYAAEDADVTLRLWRLFKPQLHRARVTTVYETLERPLVPVLAEMEMAGVQVDRDTLSRMSNAFAQKM 570
gi 126463449  491 QITFDRVPVEQAVCYAAEDADVTFRLWKLFKPQLHRARVTTVYETLERPLVPVLAEMEMAGVQVDRDTLSRMSNAFAQKM 570
gi 110677750  488 AITFDKVPLSEAVPYAAEDADVTLRLWQQFKPALHRAQVTKVYETLERPMVAVLADMERAGIKVDRDTLSRMSNAFSQKM 567
gi 56698655   488 AITFDKVAIDEATAYAAEDADITLRLWQLFKPQLHRAQVTTVYETLERPLVPVLAEMEMHGVKVDREVLSRMSNAFAQKM 567
gi 99082604   490 AITFDRVSIEDATPYAAEDADITLRLWQQFKPQLHQKQVTTVYETLERPLVPVLAQMEQHGIKVDRDTLSRMSNAFSQKM 569
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91975436   664 ARIEAEIRELAGEDINIGSPKQLGDILFGKMGLPGGSKTKTGAWSTSAQVLDELAEQGHEFPRKILDWRQVSKLRSTYTD 743
gi 167644193  604 ADFEARAQELVGRPFNLGSPKQIGDVLFGEMALKGGKKTATGQWSTDSDVLEALALE-HELPRVLLDWRQLSKLKGTYTE 682
gi 159045449  567 AGLEAEIHELAGESFNVGSPAQLGEILFEKMGFEGGKTGKSGKYSTPADVLEDLATE-HDLPRRVLDWRQLSKLKSTYTD 645
gi 89054174   564 AGLEAEIHELAGESFNVGSPAQLGEILFDKMGLQGGKKGKTGKYSTGADILEDLATE-HDLPGRVLDWRQLSKLKSTYTD 642
gi 77464609   571 AGLEAEIHALAGGPFNVGSPKQLGEILFEKMGLPGGQKGKNGAWGTGADVLEDLAAEGHDLPARVLDWRQLSKLKSTYTD 650
gi 146276256  571 AALEAEIHGLAGGPFNVGSPKQLGEILFERMSLQGGVKGKNGAWGTGADVLEDLAAEGHDLPARVLDWRQLSKLKSTYTD 650
gi 126463449  571 AGLEAEIHALAGGPFNVGSPKQLGEILFEKMGLPGGQKGKNGAWGTGADVLEDLAAEGHDLPARVLDWRQLSKLKSTYTD 650
gi 110677750  568 AALEDEVYTLVGRKFNVGSPKQLGEILFDEMGLQGGKKGKTGAYATGADVLEDLATE-HELPRRILDWRQLSKLKSTYTD 646
gi 56698655   568 AGLEAEIHELAGEPFNVGSPAQVGEILFDKMSLEGGKKGKTGKYSTPADVLEDLATE-HELPARILDWRQLSKLKSTYTD 646
gi 99082604   570 AALEAEIHELAGETFNVGSPKQLGEILFDKMSLPGGKKGKTGAYATGADILEDLATE-HTLPARVLDWRQLSKLKSTYTD 648
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91975436   744 ALPNYVHPQTQ-RVHTTYALAATTTGRLSSNEPNLQNIPVRTEDGRKIRRAFIASPGYKLVSADYSQIELRLLSEVAEVP 822
gi 167644193  683 NLIAAIAPGGGnRVHTSYALAATTTGRLSSSDPNLQNIPIRTEEGRKIRKAFVAAPGKVLISADYSQIELRLLAHIGDIP 762
gi 159045449  646 ALQDHINPETG-RVHTSYSIAGANTGRLASTDPNLQNIPVRSEEGRRIREAFVAEPGHVLVSLDYSQIELRILAHIAGID 724
gi 89054174   643 ALQDHINADTG-RVHTSYSIAGANTGRLASTDPNLQNIPIRSEEGRRIREAFVAEPGKVLVALDYSQIELRILAHIAGID 721
gi 77464609   651 ALQEHIHPETG-RVHTSYSIAGANTGRLASTDPNLQNIPVRSEEGRRIREAFVAPPGKLLVSLDYSQIELRILAHIADIP 729
gi 146276256  651 ALQEHIHPETG-RVHTSYSIAGANTGRLASTDPNLQNIPVRTEEGRRIREAFVAPKGKLLVSVDYSQIELRILAHIADIP 729
gi 126463449  651 ALQEHIHPETG-RVHTSYSIAGANTGRLASTDPNLQNIPVRSEEGRRIREAFVAPPGKLLVSLDYSQIELRILAHIADIP 729
gi 110677750  647 ALQDHINPDTG-RVHTSYSIAGASTGRLASTDPNLQNIPIRSEEGRRIREAFVAEEGKTLVALDYSQIELRILAHIADIP 725
gi 56698655   647 ALQTHINPDTG-RVHTSYSITGANTGRLASTDPNLQNIPVRTEEGRRIREAFVAEPGNVLLSLDYSQIELRILAHIADIP 725
gi 99082604   649 ALQEHIHPETG-RVHTSYLQTGANTGRLASSDPNLQNIPVRSEEGRRIREAFVADEGNVLLSLDYSQIELRILAHVAGID 727
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91975436   823 ALRKAFQDGIDIHAMTASEMFGVPVEGMPSEIRRRAKAINFGIIYGISAFGLANQLGIPREEAGAYIKRYFERFPGIRAY 902
gi 167644193  763 QLKKAFQEGLDIHAMTASEMFNVPIEGMPSEVRRRAKAINFGIVYGISAFGLANQLSIPQGEAGAYIKTYFERFPGIQAY 842
gi 159045449  725 ALKTAFRDGLDIHAMTASEMFDVPLDEMTPEVRRQAKAINFGVIYGISGFGLARNLRIPRAEAQAFIDTYFERFPGIRAY 804
gi 89054174   722 ALKDAFKDGQDIHAATASEMFNVPLEEMTPDVRRQAKAINFGVIYGISGFGLARNLRIPRAEAQGFIDRYFERFPGIRTY 801
gi 77464609   730 ALKQAFREGHDIHAMTASEMFNVPLEGMDPMIRRQAKAINFGVIYGISGFGLARNLRIPRADAQGFIDRYFERFPGIRGY 809
gi 146276256  730 ALKQAFREGHDIHAMTAAEMFNVPLEGMDPMVRRQAKAINFGVIYGISGFGLARNLRIPRADAQGFIDRYFERFPGIRAY 809
gi 126463449  730 ALKQAFREGHDIHAMTASEMFNVPLEGMDPMIRRQAKAINFGVIYGISGFGLARNLRIPRADAQGFIDRYFERFPGIRGY 809
gi 110677750  726 ALKTAFDDGQDIHAMTASEMFDVPLDEMTPEIRRQAKAINFGVIYGISGFGLARNLRIPRSEAQGFIDRYFERFPGIRAY 805
gi 56698655   726 ALKQAFADGLDIHAMTASEMFDVPLDQMTPEVRRRAKAINFGVIYGISGFGLARNLRIPRAEAQEFIDRYFERFPGIRTY 805
gi 99082604   728 ALKQAFADGHDIHAMTASEVFDVPLEEMTPDIRRKAKAINFGVIYGISGFGLARNLRIPRGEAQGFIDRYFERFPGIRQY 807
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91975436   903 MDETRDFCRAHGYVETLFGRKCHYPDIKASNPSIRAFNERAAINARLQGSAADIIRRAMGRMEDALAEKKLSAQMLLQVH 982
gi 167644193  843 MEATKAFVREHGYVTTIFGRKINIPDIGGKSVAHRQFAERAAINAPIQGAAADVMRRAMVRMPGALKAAGLSSRMLLQVH 922
gi 159045449  805 MDDTVAFAKEHKYVQTLFGRKIHTPEIGAKGPQA-GFAKRAAINAPIQGTAADIIRRAMVRMPAAIADLP--ARMLLQVH 881
gi 89054174   802 MDDTKKFAKENLYVQTLFGRKIHTPEINAKGPGA-GFAGRAAINAPIQGTAADIIRRAMIRMEDAIEGIP--AKMLLQVH 878
gi 77464609   810 MDETIAFAKANGHVETLFGRRINTPEINAKGPGA-GFARRAAINAPIQGTAADVIRRAMIRMPKAIRGMP--ATMLLQVH 886
gi 146276256  810 MDETVAFAKAHGFVQTLFGRRINTPEINAKGPGA-GFARRAAINAPIQGTAADVIRRAMIRMPKALDGLP--AKMLLQVH 886
gi 126463449  810 MDETISFAKANGHVETLFGRRINTPEINAKGPGA-GFARRAAINAPIQGTAADVIRRAMIRMPKAIRGMP--ATMLLQVH 886
gi 110677750  806 MDDTKAFAKEHGYVETLFGRRIHTPNIGAKGPQA-GFAARAAINAPIQGTAADVIRRAMIRMPAAIAELP--AKMLLQVH 882
gi 56698655   806 MDDTIAFAKEHGFVQTLFGRRIHTPEINAKGPHA-GFARRAAINAPIQGTAADVIRRAMVRMPDAIRDLP--AKMLLQVH 882
gi 99082604   808 MDDTVNFAKEHGYVQTLFGRKIHTPEIAAKGPRA-SFAKRAAINAPIQGTAADVIRRAMVRMPEAIAHLP--ARMLLQVH 884
                         970       980       990      1000      1010
                  ....*....|....*....|....*....|....*....|....*....|.
gi 91975436   983 DELIFEVPDDEVAATLPVVRHVMQDAPFPAVLLNVPLQVDARAADNWDEAH 1033
gi 167644193  923 DELVFEAPEAEAQATIDVAREVMQGAAAPAVTISVPLTVEARAAANWDEAH 973
gi 159045449  882 DELIFEVEEDAVDRVIPAVRQVMEGAAAPVVHLDVPLTVDAGQGRSWAEAH 932
gi 89054174   879 DELVFEVDEDATDTLIARAREVMEGAADPAVHLSVPITVDAGQGETWAEAH 929
gi 77464609   887 DELLFEVEEEAADALIERVREVMEGAADPAVKLTVPLTVEAGRGLNWAAAH 937
gi 146276256  887 DELLFEVDEAAADPVIARVREVMESASEPAVKLSVPLTVDAGRGANWAEAH 937
gi 126463449  887 DELLFEVEEEAADALIERVREVMEGAADPAVKLTVPLTVEAGRGLNWAAAH 937
gi 110677750  883 DELLFEVDQGAQDALIEAARSVMESAADPVVHLDVKLTVDAGQGPNWAVAH 933
gi 56698655   883 DELLFEVAEEAVEDTIAAARDIMEGAADPAVRLDVRLVVDAGRGANWAEAH 933
gi 99082604   885 DELLFEVPEDHVEETISVAREIMEGAADPAVHMDVKLVVDAGRGQNWAEAH 935
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap