Conserved Protein Domain Family
flgK

?
PRK07521: flgK 
flagellar hook-associated protein FlgK; Validated
Statistics
?
PSSM-Id: 236038
View PSSM: PRK07521
Aligned: 55 rows
Threshold Bit Score: 442.065
Threshold Setting Gi: 77464882
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86356331    1 MSLTSALNTAQNIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTTSL-----NGAQVVK-IDRAQEDALLRQYLKSSSQD 74
gi 294675565   1 MSIASAFNFAISGLTASSRKAEVVSSNIANAMTEGYARRELSIASQTlggtgGGVRILG-VNRIVNQVVQQDLLLMDSAA 79
gi 77464882    1 MSITGALSNALSGLNVTSRSIENSSNNVANALTEGFARRELEVTARSyggggQGVRTVG-IDRMVNMALVADRRLADAAT 79
gi 126463724   1 MSITGALSNALSGLNVTSRSIENSSNNVANALTEGFARRELEVTARSyggggQGVRTVG-IDRMMNMALVADRRLADAAT 79
gi 146278770   1 MSITTALSSALSGLTVTSRGVETAANNIANALTEGFARRELEVSARAyggegRGVRVVG-VNRIIDMTLVGDRRLADAAT 79
gi 221640803   1 MSITGALSNALSGLNVTSRSIENSSNNVANALTEGFARRELEVTARSyggggQGVRTVG-IDRMVNMALVADRRLADAAT 79
gi 110677962   1 MSISGALSNAMTGLRAAGRTSEVISANLANAMTPGYGVRNLSLSSSQ-----LGGVAIDgVMRNVDPSLLADLRLADASF 75
gi 56695116    1 MTISAALNSALSGLTAASRATGVASDNIANALTPGYARRSLEVAGNTig--gAGVRILG-VVRNSDPVLLASRRGADAAQ 77
gi 99082780    1 MSLSTALSSAMTGITAASRSTSVISDNLANALSEGYYRRTLDLSSNGa----AGGVRIGsVQRMIDPAIQKSVRSAEANY 76
gi 159045918   1 MSVTSTLGNALSGLTAASKAASVVSSNIANATTEGYGVRQVQTTSVSlngqgSGVQVVS-VSRNVNEGVLADRRAADAAY 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86356331   75 SAQQTLLSGLEDLKSIMGGNDYETSPSTYLGVFQQKLQAFRTSPGSTVAAQGAITAAQDVANSLNNASQSVQDVRANADK 154
gi 294675565  80 ANTTAKADFYNRLETQIGDPETAGSLSATMSDFESALLTAASMPDSTARLTTAVRAASTVADKLNSISEDLQAARLTADK 159
gi 77464882   80 GDRDTRAAFYQALADATG-DTGGGSLLARISAFSASLVTAASRPESQARLQDVLDKAQSLAAGLRAASDAVLEARRAADA 158
gi 126463724  80 GDRDTRAAFYQALADATG-DTGGGSLLARISAFSASLVTAASRPESQARLQDVLDRAQSLAAGLRAASDAVLEARRAADA 158
gi 146278770  80 GDRNTRSAFYESIAKVVG-DTAEGSLLSRITDLSAALASAASRPESTVRLQDVLDTAQALVSGLNAASDAVLTARRGADA 158
gi 221640803  80 GDRDTRAAFYQALADATG-DTGGGSLLARISAFSASLVTAASRPESQARLQDVLDKAQSLAAGLRAASDAVLEARRAADA 158
gi 110677962  76 GNANNRTKFLNDFENLLGTPEEANSLAGRMAEFERTLITAASRPDAPERLNSVVDAARDIATLISKASDGVQQARSDADR 155
gi 56695116   78 GYADGVSGFHTRMARLVGNVNDPRSVPNLIAEFESSLIAAASTPSVQTRLDAVATAASELATALNAASNGLREARNDADR 157
gi 99082780   77 AATSVTAGFYARVSEQVGTVNDAYSIAQRMTDMETALIEATSLPDSDARLNDLSMQAGELAMSIRDAAEGVSSLRNKAED 156
gi 159045918  80 AQAATLASFYGSVEGAIGLPGDEGSLSSEFSQFEAALVEAGSRPDSDARLANVVRAAESLAGTLNDLSADIQSERLEAEK 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86356331  155 EIATAVDTLNTLLSEFEKANNAVKTATATGADTSGALDEREKVLKQISQIVGVSATTRDNNDMVLSTPDGTILFE-TIPR 233
gi 294675565 160 SIAKQVRTLNETLVQLQEMNRTITTQISIGNDAAGLMDERQSLVNQIAEIVPLRVVQRENNQIALFTTGGAILLD-GSAA 238
gi 77464882  159 SIADQIKTLTATLARVQQMNATITEMRVNGRDSSAVEDERQRLVDGISTIVPVREVTRQNGQIALFTAGGAALLD-GRVA 237
gi 126463724 159 SIADQIKTLTATLARVQQMNATITEMRVNGRDSSAVEDERQRLVDGISTIVPVREVTRQNGQIALFTAGGAALLD-GRVA 237
gi 146278770 159 SIADQVDQLNAGLESVRDLNLRITRLRVTGRDSSALEDERQRVVDSMATIVPLREIERENGQIALFTTGGAALLD-GRVA 237
gi 221640803 159 SIADQIKTLTATLARVQQMNATITEMRVNGRDSSAVEDERQRLVDGISTIVPVREVTRQNGQIALFTAGGAALLD-GRVA 237
gi 110677962 156 AIQVQIDRLNTSLQSVKELNSQITRTISTGSDASALFDNRQAIVDEINAIVPVRLVPRDNGQIALYSTGGAILID-GGVA 234
gi 56695116  158 SIGQQVDRLNTVLQNVETLNGRIQSVKLSGGDSAPLLDQRQKLIDEVNTMIPVNVVARDHGSVALFTDGGAILLD-GPAA 236
gi 99082780  157 SIAALVQGLETNLETLNDLNRKILAAEVRGQDPSGLEDQRDSLIDAINEVIPVQVHKRDNNQTALYTNSGIKLIDgGSVA 236
gi 159045918 160 EIARQVDNLNTSLAQIQDLNGDIRLQIAAGNDPLGLMDQRQVLIDQIATIVPVSVVDRDFGQVALITESGGVLLD-GTAA 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86356331  234 KVTFKSQDIYTATTVGNS-----VYIDGVALPLGKGSTTTGQGSLQSLLQIRDEIAPNFQKQLDETARGLVSLFKEQ--N 306
gi 294675565 239 TIGFDGAGVMAPHLTLDSgalsgLTINGYPTSTKD-DGPLGGGTLGAAFAVRDELAPEAQSQLDAFARDLMTRFEDPsvD 317
gi 77464882  238 DIAFEPEPGLVAASSVAAgdlglLKVNGLPLDLAGDGGMMGTGSLSAAFAVRDDLAPAEQARLDALAQDLIGRMAAA--D 315
gi 126463724 238 DIAFEPEPGLVAASSVAAgdlglLTVNGLPLDLAGDGGMMGTGSLSAAFAVRDDLAPAEQARLDALAQDLIGRMAAA--D 315
gi 146278770 238 EIGFTPTPGLVSASSSLGs----LTMDGRPISVPGDPGLMAGGSLSAAFAVRDTLAPNEQQRLDALARDLIERFTAA--D 311
gi 221640803 238 DIAFEPEPGLVAASSVAAgdlglLTVNGLPLDLAGDGGMMGTGSLSAAFAVRDDLAPAEQARLDALAQDLIGRMAAA--D 315
gi 110677962 235 EIEFNAVNQVTPFMTLGGgtlsgLSVNGYPVRTDSARGALGGGTLGAHFEIRDELGTSAQTQLDAFARDLIERFQDPavD 314
gi 56695116  237 QLSFTPTLQTMPHMTLENgllsgLELNGMPLRLSGPTSAIRGGSLAAAFEVRDDLAIEAQQDLDAVARDLIERFEAPglD 316
gi 99082780  237 EFSFDETRLVTPYMTLGNgqlsgLEIDGKQIDTSI-NGKIGGGSLAAQFHVRDVASVQAQEDLDTMAADLIQRFQDPavD 315
gi 159045918 239 EISFRDVGLITPDMTVASgglyqVEINGSPVDSTSPNNPLKGGSLDALFEIRDELAVSAQGDVDAVARDLIERFQNSaiD 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86356331  307 TAGPPaYVPGLFTWSGGTVDTGAtaVAGMASTITVSTRVITSQGGDPMRLRDGGVNAAGvV-LNTSGVSGYTAELDRLYT 385
gi 294675565 318 TTLSA-GDPGLFTDAGSAFDAST--EVGLAGRIRMNAIVDPEQGGSSWHLRDG-------LmAAAPGAVSDGTILNALSA 387
gi 77464882  316 ASLGA-GDAGIFTDDSAAFDPAA--PAGLAGRLSVNALADPDRGGALWHLRDG-------LqRPSEGDSGDPTLLNALAA 385
gi 126463724 316 GSLGA-GDAGLFTDDGAAFDPAA--PAGLASRLSVNALADPDRGGALWHLRDG-------LqRPSEGDSGDPTLLNALAA 385
gi 146278770 312 SSLSA-GDAGLFTDEGLAFDAAN--ASGLAGRISVNGKVDPERGGALRYLRDGLQSAAG--------STGDGTLFNAMSA 380
gi 221640803 316 ASLGA-GDAGLFTDDGAAFDPAA--PAGLASRLSVNALADPDRGGALWHLRDG-------LqRPSEGDSGDPTLLNALAA 385
gi 110677962 315 ASLAV-GDPGIFTDAGLAFDPVN--EIGLSARLSVNAAVDERQGGESWRIRDG-------VnALTPGDVGDARLIQALSD 384
gi 56695116  317 PTAAP-TDAGLFTDNGARFSASA--QTGLAGRLKLNASVDPGQGGQSWRLRDG-------LgAAVPGAVGNAQQINAFHQ 386
gi 99082780  316 PTLGA-TDPGIFTDQGAFFDPVN--TLGVANRIELNSIISMSGSAETWRLRDG-------LnATAIGERGDTTILNNYAE 385
gi 159045918 319 PTLSA-GEPGLFTDAGALVDPAN--EVGLAGRIELNARVDPAKGGEVWRVRTG-------LgATSPGDPGAGGIILALSD 388
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86356331  386 AMTSDMDFDPAAgapvgfdattGIDSNVSIMEYATNSLGWLEQYRSNATTAAENTAAALSRSDEAYSNETGVNLDEELTL 465
gi 294675565 388 ALTRESAPASGN----------YGSALRSASGLAAELLSFASSGRQSAELTQGYATARHEALTE-MSLADGVDTDYEMQS 456
gi 77464882  386 ALDARTAHAAN-----------GLSGTFSFSGLAAETVSGAAVALVSAEAEASFASARRDELQ-ALILADGVDTDREMEQ 453
gi 126463724 386 ALDARTPHAAN-----------GLSGTFSFSGLAAETVSGAAVALVSAEAEASFASARRDELQ-ALILADGVDTDREMEQ 453
gi 146278770 381 ALDRRVPCSAA-----------DIEGSFSLAGLATEIVSGLSSSLLSADQEASFASARRDELQ-VLVLGDGVDTDKELEQ 448
gi 221640803 386 ALDARTPHAAN-----------GLSGTFSFSGLAAETVSGAAVALVSAEAEASFASARRDELQ-ALILADGVDTDREMEQ 453
gi 110677962 385 TLSAKRAPASGD----------FGAGAFSAMNLISTFTSQVGADRSRAEQTLSFASSQFDELTQQV-LANGVDSDQELQR 453
gi 56695116  387 ALTATRTPSDPR----------FGTGDMTANQVGAALLSRVAQNESLATERLTFASASRTEMQ-KLELEQGVDTDVELQM 455
gi 99082780  386 AMEATNTITSPG----------LGSGDYSAYAIAANLMTNFTQENTWAEQELAYSSAIFSDIQ-SRELEQGVDTDSELQT 454
gi 159045918 389 ALSEPKVVASGS----------FSSIPRTAAALASDLLSTIGAARQASENEVSYTAAKWETLR-SLELEGGVDTDAELQK 457
                        490       500
                 ....*....|....*....|....*...
gi 86356331  466 LLDIEQSYKAATKILNAVDEMLKSLLDI 493
gi 294675565 457 LLVIEKAYAANAKVVQTIDAMLQELLDI 484
gi 77464882  454 LLLLERAYAANAKVVTACDDLLQYLLEM 481
gi 126463724 454 LLLLERAYAANAKVVTACDDLLQYLLEM 481
gi 146278770 449 LLLLERAYAANAKVVTACDALLQYLLEM 476
gi 221640803 454 LLLLERAYAANAKVVTACDDLLQYLLEM 481
gi 110677962 454 LLIVEQAYAANARMIEAADEMMQTILRI 481
gi 56695116  456 LMQIEQAYAANARMIETVGEMMDTLLRL 483
gi 99082780  455 LMMVETIYAANARMIQAIDEMMQELMRL 482
gi 159045918 458 LLMIETAYAANARVIQTVDEMLDLLLRI 485
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap