Conserved Protein Domain Family
PRK07516

?
PRK07516: PRK07516 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 181013
View PSSM: PRK07516
Aligned: 47 rows
Threshold Bit Score: 603.092
Threshold Setting Gi: 86741198
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146340101  11 SMTASIVGWAHTPFGKFDAETVESLVVKVANEALADAGIAAGDVDEIVLGHFNAGFSPQDFTASLVLQADPALRFKPATR 90 
154245283  72 GNAVSIVGWGHSPFGRLAHMDMEALIAAVCHEALVHSGFPAERMDGVWLGNLNGGFVPEIFCSSLPMNGEPGLRWKPATR 151
70731005    3 HESVCIVAAAHTRFGRLDG-SLEDLVVQVTRDVLVDAAIDAGAIDALFLGQFNSGLVPDGFPASLMLQADPQLRFKPATR 81 
226944317   3 TDSVSIVASGHTRFGRLEGRTLEDLIVAATREALEEAAVDAAEIDAVFLGHFNSGMVPDGFPASLTLQADPALRFKPASR 82 
161525632   1 -MTVAIVGWGHLPFGRLDALSLEDLIVGAGRAALSDAGMPADSVDGIWLGNLNGGFVPDIFAAPLALNCDAGLRWKPAVR 79 
189349639   1 -MTVAIVGWGHLPFGRLDALSLEDLIVGAGRAALSDAGMPADSVDGIWLGNLNGGFVPDIFAAPLALNCDAGLRWKPAVR 79 
56695913    1 --MVSIAGWGHTKFGKLTDMSVEDMITAAGRDALADAGLGAEAVDGIWVGHFNAGLVGDGFPASLAMSIDPALRFKPATR 78 
163855190   3 RHTVSLVGSGHTKFGRLDALRLEDLIVSAAREAMDDAGVPASEVDAVFLGHFNSGMVSDGFASSLIHQASPDLRFKPAVR 82 
89902052    1 -MGVCIVGWAHSPFGRLDTLDLESLIGGVTRASLGHAGIAGSEVDGVWLGHLNGGFVPDIFTSSLALQADDALRWRPATR 79 
104781647   3 HDSVSIVAAAHSPFGRLDGLNLEDLIVKVTRDALADAAIEAAEIDALFLGHFNSGLVADGFPASLMLQADPQLRFKPATR 82 
146340101  91 VENACATGSAAVHQGIRAIAAGAAKIVLVVGVEQMTRTPGPEIGKNLLKASYLPEDGDTVGGFAGVFGKIAQGYFQKYGD 170
154245283 152 VENACASGAGAIFAACDAIQSGRARLALVVGAEKMTAVSGEEVTRILGSASYVKEEANCGKTFPSIFGEIAGAYFERYGD 231
70731005   82 CENACASGSAAIQAGINAIRSGAAELVLVVGAEKMTGNSTAEVTRALAGAGYQNDPQEAGLSFAQLFGQVAQRYTERYQS 161
226944317  83 CENACASGSAAIQAGICAIRSGAAELVLVVGAEKMTANSTQEVTRALAGAGYQNDPQEAALSFPQQFGLAARRYGERYRD 162
161525632  80 VENACASGSAAVYAACDAIEAGRARIALVIGAEKMTSVSGAEVTRILGNCGYSGEAGNPPGGFPGIFAEVARDYFEQYGD 159
189349639  80 VENACASGSAAVYAACDAIEAGRARIALVIGAEKMTSVSGAEVTRILGNCGYSGEAGNPPGGFPGIFAEVARDYFEQYGD 159
56695913   79 LENACASGSAAVFAARQAILSGEARVALVIGVEKMTHLPTAEVAAALGHAAYQKEEAGL--SFPGVFAQFAQAYFERYGD 156
163855190  83 CENACASGAAAIAAGVAAIQAGQAEIVLVVGAEKMTHNTTADVTRALAGAGYQNDADEAALSFPQVFARAAQEYTRRYRD 162
89902052   80 VENACASGAAALYAACDAIEAGRARVALVIGAEKMTGVSGPEVTRILGNASYVKEEAARGLTFPGIFAQVALAYFERYGD 159
104781647  83 CENACASGAAAIQAGIHAIRSGAAELVLVVGAEKMTGNSTVEVTRALAGAGYQNAMSEAGLSFAQLFGQVAQQYTERYHS 162
146340101 171 QSDALALIAAKNHKNGVANPFAQMRKDFGFEFCRSESEKNPYVAGPLKRTDCSLVSDGAAALVLTDSETAKKFAKAVNVR 250
154245283 232 HAQALAKIAVKNHANGVSNPFAQMRKALDFEFCNTVSEKNPVIAGPLRKTDCSLVSDGAAAVVLASDDLIGEAQRAVRIR 311
70731005  162 PLAAMAAIAVKNHANAMANPLAQMHRAMDFAHCNSVSPGNPLIAEPLRLTDCSLISDGAAAILLASPRRAREFRREVAIR 241
226944317 163 PLGAMAAIAVKNHANAMHNPLAQMHREMSLEHCATVSESNPLIAPPLRLTDCSLISDGAAAIVLASARRAERFRRRVAIR 242
161525632 160 HSATLAAIAAKNHANGVANPWAHMRRDLGFDFCNTVSEKNPLIAPPLRKTDCSLVSDGAAALVLVAQELAADFAKAVSIR 239
189349639 160 HSATLAAIAAKNHANGVANPWAHMRRDLGFDFCNTVSEKNPLIAPPLRKTDCSLVSDGAAALVLVAQELAADFAKAVSIR 239
56695913  157 HSRALARIAAKNHGNSVNNPLAQLQKPLDEAFCAEVSDRNPIIAAPLKKTDCSLVSDGAAALVLVADDMLGDVTKAARLR 236
163855190 163 PLPAMAAIASKNHGNAMRNPLAQMHRALDVEACNTVSDRNPLIAPPLRLTDCSLVTDGAAAVILASAERARSFPREVALR 242
89902052  160 HSATLAHIAAKNHANGVRNPWAQMRRDLGFEFCNTVSDRNPLIAAPLRKTDCSMVSDGAAAVILADSSIARQFPRAVALR 239
104781647 163 PLASMAAIAVKNHANAMANPLAQMHRVMDFEHCNNPSPSNPLIAPPLRLTDCSLISDGAAAIILASPRRARSMRRQVAIR 242
146340101 251 ATAHAQDFLPMSKRDILAFEGCTVAWQRALEKAGVTLSDLSFVETHDCFTVAELIEYEAMGLTPRGQGARAIKEGWTLKD 330
154245283 312 ARAQVNDLLPMSRRDPVRFEGPRRAFAAAFAEAGITVGDLSFAEVHDCFTIAELLAYEAMGLAPEGQGARVLEDGTVARG 391
70731005  242 ALSQVNDFLPMARRDVLAFEGPQLAIQGALHEAGLGLDDLAFAEVHDCFTIAELLIYEAMGLAPKGEGHRALDEGWVNAD 321
226944317 243 AMAQVNDFLPLSKRDFLAFEGPQRAIRSALEQAGVSLADLQFAEVHDCFTIAELMIYEAMGLAPRGEGFRALEEGTVLAG 322
161525632 240 ARVQVNDYLPLAQRRAIEFNGPKRAWKHALSEAGCTIDDLSFAEVHDCFTIAELLSYEAMGLAPAGQGHRLIEDGTVARD 319
189349639 240 ARVQVNDYLPLAQRRAIEFNGPKRAWKHALSEAGCTIDDLSFAEVHDCFTIAELLSYEAMGLAPAGQGHRLIEDGTVARD 319
56695913  237 GVAQVNDIMPMSQRDLLAFEGPRRAIHRAYDRAGVTVSDIDVAEVHDCFTIAELLIYEAMGLAAHGHAADLLEGGVVHEG 316
163855190 243 SLAHVSDLLPMSARDFLAFEGPRKAIGDALAGAGIQLRDLDFAEVHDCFTIAELLIYEAMGLAPAGEGHRVLDDGTVMRG 322
89902052  240 SRAQVNDFLPMSRRDAVAFEGPRRAWAKALDNARCSVHDLSLAEVHDCFTIAELLTYEAMGLAAPGQGARLLAEGTVAAG 319
104781647 243 SMVQVNDFLPLSRRDMLAFEGPQRAIHGALRETGVTLNDLSFAEVHDCFTIAELLIYEAMGLAPRGEGHRAIDDGTVRPG 322
146340101 331 GKLPVNPSGGLKAKGHPIGATGVSMHVMTAMQLTGTApEGMQLPNAKLGGIFNMGGAAVANYVSILEPAK 400
154245283 392 GRLPVNVSGGLKAKGHPIGATGVSMHVLSAMQLTGTA-GDMQVPGASLGGVFNMGGSAVANYVSVLEPVK 460
70731005  322 GRLPVNLSGGLKAKGHPVGATGVSMHALGFRQLTGEP-IGLAARSPEFGLLFNMGGMAVANYASVLQAVR 390
226944317 323 GRLPVNLSGGLKAKGHPVGATGVSMHAMAFRQLVGDP-VGIALRRPEFGLVFNMGGMAVANYASVLQAQG 391
161525632 320 GRFPVNASGGLKAKGHPIGATGVSMHVLAAMQLAGQA-GEMQIPDATLGGVFNMGGAAVASYVSILERSR 388
189349639 320 GRFPVNASGGLKAKGHPIGATGVSMHVLAAMQLAGQA-GEMQIPDATLGGVFNMGGAAVASYVSILERSR 388
56695913  317 GRLPVNLSGGLKAKGHPVGATGVSMHALIARQVLGQA-DAMQHPGAELGLVFNMGGSGVANYASILEPVK 385
163855190 323 GALPVNLSGGLKAKGHPVGATGVSMHALGFRQLTGRA-GEMQVDGASLGLVFNMGGAAVANYASVLEAKR 391
89902052  320 GKLPINPSGGLKAKGHPIGATGVSMHVLAAMQLMGEA-GEMQVPGAELVGVFNMGGSAVANYVSILERLQ 388
104781647 323 GRLPVNLSGGLKAKGHPVGATGVSMHALGFAQLVGEP-IGLGVPGAEFGLLFNMGGMAVANYASVLQAVR 391
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap