Conserved Protein Domain Family
rpoH2

?
PRK07500: rpoH2 
RNA polymerase factor sigma-32; Reviewed
Statistics
?
PSSM-Id: 236033
View PSSM: PRK07500
Aligned: 47 rows
Threshold Bit Score: 437.545
Threshold Setting Gi: 240140689
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 298293645   1 MSDKAGRSTQIARAAMAAPLLDRTEEYELARRWAEQHDEKALHALIHAHMRLAIAIARRFRNYGLPMPDLIQEGHIGLME 80
gi 294676015   1 MALDGMTDDTLPRQAMRAEYLDAETEAALARAWRDHRDEAALHRLVSAYMRLAISMASKFRRYGAPMNDLIQEASLGLMK 80
gi 77464172    1 MALDGYTDQTMSRQAMRAELLDAETELRLAYAWRDQRDERALHRLITAYMRLAISMASKYRRYGAPMNDLIQEASLGLMK 80
gi 126463015   1 MALDGYTDQTMSRQAMRAELLDAETELRLAYAWRDQRDERALHRLITAYMRLAISMASKYRRYGAPMNDLIQEASLGLMK 80
gi 146276534   1 MALDGYTDQTMSRQAMRAELLDAQTELRLAYAWRDQRDERALHRLITAYMRLAISMASKYRRYGAPMNDLIQEASLGLMK 80
gi 221640041   1 MALDGYTDQTMSRQAMRAELLDAETELRLAYAWRDQRDERALHRLITAYMRLAISMASKYRRYGAPMNDLIQEASLGLMK 80
gi 110678526   1 MALDSTRDMALSRKAMKAELLDAETELELAYAWRDERCEKSLHRLITAYMRLAISMASKFKRYGAPMNDLIQEAGLGLMK 80
gi 56695321    1 MALNDPQDKRMSRQAMKAELLDAETELALAYAWRDHRDEAALHRLITAYMRLAISMAAKFKRYGAPMNDLIQEAGLGLMK 80
gi 89053397    1 -MAFDMGDQSLSRRAMKAELLDAETELRLAYAWRDDRCEESLHRLVTAYMRLAISMAAKFKRYGAPMNDLIQEAGLGLMK 79
gi 159045518   2 ALDGYSGEMSLSRRAMQAELLDAETELRLAYAWRDQRDEEALHRLITAYMRLAISMAAKFKRYGAPMNDLIQEAGLGLMK 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 298293645  81 AASRFETTHEVRFATYASWWIRAAIQDYVLRNWSIVRGGTSSGQKALFFNLRRVRARLER-ANggaGETTREEMHRSIAE 159
gi 294676015  81 AADKFDPDRGVRFSTYAVWWIKASIQEFVMRNWSMVRTGSTSSQKALFFNLKRVQAQIQReAEaegVVLDGAQLREKVAI 160
gi 77464172   81 AADKFDPDRGVRFSTYAVWWIKASIQDYVMRNWSLVRTGSTSSQKALFFNMRRVQARLEReASqrgEALDAHQLREMVAH 160
gi 126463015  81 AADKFDPDRGVRFSTYAVWWIKASIQDYVMRNWSLVRTGSTSSQKALFFNMRRVQARLEReASqrgEALDAHQLREMVAH 160
gi 146276534  81 AADKFDPDRGVRFSTYAVWWIKASIQDYVMRNWSLVRTGSTSSQKALFFNMRRVQARLEReASqrgEQLDAHQLRELVAH 160
gi 221640041  81 AADKFDPDRGVRFSTYAVWWIKASIQDYVMRNWSLVRTGSTSSQKALFFNMRRVQARLEReASqrgEALDAHQLREMVAH 160
gi 110678526  81 AADKFDPDRGVRFSTYAVWWIKASIQDYVMRNWSMVRTGSTSSQKSLFFNMRRVQARLEReSAasgEPLDRHQLRQMIST 160
gi 56695321   81 AADKFDPDRGVRFSTYAVWWIKASIQDYVMRNWSMVRTGSTSSQKSLFFNMRRVQARLEReAAtdgLALDRHQLHQMIAS 160
gi 89053397   80 AADKFDPDRGVRFSTYAVWWIKASIQDHVMRNWSMVRTGSTSSQKSLFFNMRRVQARLEReAMksgDTLDKHQLRQMIAT 159
gi 159045518  82 AADKFDPDRGVRFSTYAVWWIKASIQDYVMRNWSMVRTGSTSSQKSLFFNMRRVQARLEReAAsagEPLDRHQLRQMIAT 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 298293645 160 KLGVSEIEVARMDARLNVPDLSLNAPLSFGEEDGaERMDQLVAADPLPDEQVSMEIDGERRRRWLQGALRGLNEREFRII 239
gi 294676015 161 SIGVSMADVEMMEGRLSGSDLSLNAPQSHDEDGR-EWVDTLEDEGGSPETRVTEAHDGAKMRDWLGQAMGQLSARERYIV 239
gi 77464172  161 DVGVPLSDVEMMEGRLSGSDFSLNATQSADDEGR-EWIDALEDDSAQAAEVVEGSLDAARLRGWLVSAMQQLNARERFIV 239
gi 126463015 161 DVGVPLSDVEMMEGRLSGSDFSLNATQSADDEGR-EWIDALEDDSAQAAEVVEGSLDAARLRGWLVSAMQQLNARERFIV 239
gi 146276534 161 DVGVPLSDVEMMEGRLSGSDFSLNATQSADDEGR-EWIDALEDDSAQASEVVEGSLDAERLRGWLVVAMQQLNARERFIV 239
gi 221640041 161 DVGVPLSDVEMMEGRLSGSDFSLNATQSADDEGR-EWIDALEDDSAQAAEVVEGSLDAARLRGWLVSAMQQLNARERFIV 239
gi 110678526 161 EIGVPLHDVEMMEGRLSGSDYSLNATQSTEDEGR-EWIDALEDDSAQAAETVEHHHDTEQLRAWLLQAMNDLNERERFIV 239
gi 56695321  161 EIGVPLRDVEMMEGRLSGSDFSLNATQASDEEGR-EWIEALEDESEQAAELVAHRHDTEQLRDWLIEAMQALNERERFIV 239
gi 89053397  160 EVGVPLHDVEMMEGRLAGSDYSLNATQSAEDEGR-EWIDTLEDDGEQAEHIVEHFHDTAQLRDWLIASMNALNDRERFIV 238
gi 159045518 162 EVGVPLHDVEMMEGRLAGSDYSLNATQSTEDEGR-EWIDTLEDTGAQAAELVEQDHDIETLRGWLITAMDALNERERFIV 240
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|..
gi 298293645 240 EARRLTEDSETLEVLGERLGISKERVRQIESRAIEKLRIALTRSPDVPAGAF 291
gi 294676015 240 AQRRLIDEPRTLESLGEELGLSKERIRQLEAQAFSKMRKSLESRSEEVIGFF 291
gi 77464172  240 TERKLRDVPRTLESLGEELKLSKERVRQLEAAAFAKMRRSLEAQSREVHHFL 291
gi 126463015 240 TERKLRDVPRTLESLGEELKLSKERVRQLEAAAFAKMRRSLEAQSREVHHFL 291
gi 146276534 240 TERKLRDVPRTLESLGEELKLSKERVRQLEAAAFAKMRRSLEAQSREVHHFL 291
gi 221640041 240 TERKLRDVPRTLESLGEELKLSKERVRQLEAAAFAKMRRSLEAQSREVHHFL 291
gi 110678526 240 RERKLRDAPRTLESLGQELNLSKERVRQLEAAAFGKMRKSLENQSREVLYFL 291
gi 56695321  240 RERKLRDEPRTLESLGDELGLSKERVRQLEAAAFAKMRKSLEARSREVQHFL 291
gi 89053397  239 RERKLREDPRTLESLGTELGLSKERVRQLEAAAFGKMRKTLEAQSKEVRSFL 290
gi 159045518 241 RERKLRDQPRTLESLGQELGLSKERVRQLEAAAFGKMRKNLMNQSSEVRQFF 292
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap