Conserved Protein Domain Family
PRK07491

?
PRK07491: PRK07491 (this model, PSSM-Id:102910 is obsolete)
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 102910
View PSSM: PRK07491
Aligned: 36 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15890018    2 TLPSIVIASAARTAVGSFNGHFANTPAHELGATVISAVLERAGVAANEVDEVILGQVLMAGEGQNPARQAAMKAGIPQEA 81 
161619696   3 DPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAADVDEVILGQVLTAGEGQNPARQAAMGAGCPKET 82 
148560257   3 DPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAADVDEVILGQVLTAGEGQNPARQAAMGAGCPKET 82 
23502628    3 DPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAADVDEVILGQVLTAGEGQNPARQAAMGAGCPKET 82 
163845349   3 DPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAADVDEVILGQVLTAGEGQNPARQAAMGAGCPKET 82 
62290642    3 DPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAADVDEVILGQVLTAGEGQNPARQAAMGAGFPKET 82 
82700556    3 DPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAADVDEVILGQVLTAGEGQNPARQAAMGAGFPKET 82 
153008464   3 DQKAIVIASAARTAVGAFNGAFANIPAHELGATVIKGALERAGVAATDVDEVILGQVLTAGEGQNPARQAAMDAGCPKET 82 
86359597    2 SNSSVVIASAGRTAVGSFNGAFATVPAHELGAAVIKGALARAGVDAGEVDEVILGQVLAAGEGQNPARQAAIKAGLPKET 81 
116254347   2 SNPSIVIASAGRTAVGAFNGAFATVLAHELGAAVIKGALERAGVDAGEVDEVILGQVLAAGEGQNPARQAAMKAGIPQEA 81 
15890018   82 TAFGINQLCGSGLRAVALGMQQIVTGDAAIIIAGGQESMSMAPHCAHLRGGVKMGDFKMIDTMMKDGLTDAFYGYPMGIT 161
161619696  83 TAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQESMSMAPHCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGIT 162
148560257  83 TAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQESMSMAPHCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGIT 162
23502628   83 TAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQESMSMAPHCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGIT 162
163845349  83 TAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQESMSMAPHCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGIT 162
62290642   83 TAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQESMSMAPHCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGIT 162
82700556   83 TAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQESMSMAPHCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGIT 162
153008464  83 TAFSINQLCGSGLRAVALGMQQILSGDAKIIVAGGQESMSMAPHCAHLRSGVKMGDFKMVDTMLKDGLIDAFHGYHMGIT 162
86359597   82 TAWGVNQLCGSGLRAVALGMQQIATGDAKIIVAGGQESMSMAPHAVHLRGGVKMGDTKMVDTMIKDGLTDAFHGYHMGIT 161
116254347  82 TAWGVNQLCGSGLRAVALGMQQIATGDAKIIVAGGQESMSMAPHAAHLRGGVKMGDMKMIDTMIKDGLTDAFHGYHMGIT 161
15890018  162 AENIARQWQLSRDEQDQFAVASQNKAEAAQNAGRFTDEIVAFTVKGRKADIVIDADEHIRHGASLETMAKLRPAFDKEGT 241
161619696 163 AENIARQWQLSRSEQDEFALASQHKAEAAQKAGRFDEEIVPFTVKARKGDVVVSADEYIRPGTTMEVLAKLKPAFDKEGT 242
148560257 163 AENIARQWQLSRSEQDEFALASQHKAEAAQKAGRFDEEIVPFTVKARKGDVVVSADEYIRPGTTMEVLTKLKPAFDKEGT 242
23502628  163 AENIARQWQLSRSEQDEFALASQHKAEAAQKAGRFDEEIVPFTVKARKGDVVVSADEYIRPGTTMEVLAKLKPAFDKEGT 242
163845349 163 AENIARQWQLSRSEQDEFALASQHKAEAAQKAGRFDEEIVPFTVKARKGDVVVSADEYIRPGTTMEVLAKLKPAFDKEGT 242
62290642  163 AENIARQWQLSRSEQDEFALASQHKAEAAQKAGRFDEEIVPFTVKARKGGVVVSADEYIRPGTTMEVLAKLKPAFDKEGT 242
82700556  163 AENIARQWQLSRSEQDEFALASQHKAEAAQKAGRFDEEIVPFTVKARKGGVVVSADEYIRPGTTMEVLAKLKPAFDKEGT 242
153008464 163 AENIASQWQLTRADQDEFALASQQKAEAAQNAGRFEDEIVPFTVKGRKGDIVISADEYIRPGTTIEALTKLKPAFDKEGT 242
86359597  162 AENIARQWQLSRDEQDRFAVASQNKAEAAQKAGRFTDEIIPYVIQTRKGDVTVDADEYIRHGATLEAMAKLRPAFDKEGT 241
116254347 162 AENVARQWQLSRDDQDQFAVSSQNKAEAAQKAGRFTDEIIPYVIKTRKGDVTVDADEYIRHGATIEAMGKLRPAFDKDGT 241
15890018  242 VTAGNASGLNDGAAATLLMSEQQAAKRGIKPLARIASWATAGVDPQIMGTGPIPASRKALAKAGWSINDIGLVEANEAFA 321
161619696 243 VTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVHPSIMGTGPISATRKALEKAGWSVGDLDLVEANEAFA 322
148560257 243 VTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWAMAGVDPSIMGTGPIPATRKALEKAGWSVGDLDLVEANEAFA 322
23502628  243 VTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVDPSIMGTGPIPATRKALEKAGWSVGDLDLVEANEAFA 322
163845349 243 VTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVDPSIMGTGPIPATRKALEKAGWSVGDLDLVEANEAFA 322
62290642  243 VTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVDPSIMGTGPIPATRKALEKAGWSVGDLDLVEANEAFA 322
82700556  243 VTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVDPSIMGTGPIPATRKALEKAGWSVGDLDLVEANEAFA 322
153008464 243 VTAGNASGINDGAAAVVLMDADEATKRGVKPLARIVSWATAGVDPSIMGTGPIPATKKALEKAGWSVGDLDLVEANEAFA 322
86359597  242 VTAANASGLNDGAAAAVLMSEAEAVRRGIQPLARIVSWATAGVDPSIMGTGPIPASRKALEKAGWSVNDLDLVEANEAFA 321
116254347 242 VTAANASGLNDGAAVAVLMSEAEAVRRGIQPLARIVSWATAGVDPQIMGTGPIPASRKALEKAGWSVNDLDLVEANEAFA 321
15890018  322 AQSCAVVRELGLNPDIVNVNGGAIAIGHPIGASGARVLNTLIFEMRRRNVSRGLATLCIGGGMGVAMCIEAL 393
161619696 323 AQSCAVVRDLGLNPEIVNVNGGAIAIGHPIGASGARVLTTLLYEMERRDAKRGLATLCIGGGMGVALCVERD 394
148560257 323 AQSCAVVRDLGLNPEIVNVNGGAIAIGHPIGASGARVLTTLLYEMERRDAKRGLATLCIGGGMGVALCVERN 394
23502628  323 AQSCAVVRDLGLNPEIVNVNGGAIAIGHPIGASGARVLTTLLYEMERRDAKRGLATLCIGGGMGVALCVERD 394
163845349 323 AQSCAVVRDLGLNPEIVNVNGGAIAIGHPIGASGARVLTTLLYEMERRDAKRGLATLCIGGGMGVALCVERD 394
62290642  323 AQSCAVVRDLGLNPEIVNVNGGAIAIGHPIGASGARVLTTLLYEMERRDAKRGLATLCIGGGMGVALCVERD 394
82700556  323 AQSCAVVRDLGLNPEIVNVNGGAIAIGHPIGASGARVLTTLLYEMERRDAKRGLATLCIGGGMGVALCVERD 394
153008464 323 AQSCAVVRDLGLNPHIVNVNGGAIAIGHPIGASGARVLTTLLYEMQRRDAKRGLATLCIGGGMGVALCVERD 394
86359597  322 AQACAVTKDLGWDPAIVNVNGGAIAIGHPIGASGARVLNTLLFEMKRRGAKKGLATLCIGGGMGVAMCFEAL 393
116254347 322 AQACAVTKDLGWDPSIVNVNGGAIAIGHPIGASGARVLNTLLFELKRRGAKKGLATLCIGGGMGVAMCFEAL 393
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap