Conserved Protein Domain Family
PRK07373

?
PRK07373: PRK07373 
DNA polymerase III subunit alpha; Reviewed
Statistics
?
PSSM-Id: 236003
View PSSM: PRK07373
Aligned: 16 rows
Threshold Bit Score: 800.43
Threshold Setting Gi: 170078979
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329834    1 MVKVIGRRSLGVQRIFDIGLPQDHNFLLANGAIAANCFNKSHSTAYAYVTYQTAYLKANYPVEYMAALLTASSDSQEKVE 80
gi 166366494   1 MVKIIGRQSLGRKPVYDIGVEKDHNFLLGNGLIASNCFNKSHSTAYAYVTYQTAYLKANYPVEYMTALLTASSDNQDKVE 80
gi 170078979   1 MVKIIRRKFIGHAPTYDIGLSQDHNFLLGQGLIAANCFNKSHSTAYAYVTYQTAYLKANYPVEYMTALLSASSGNKDKVR 80
gi 56750961    1 MVKIVRRRSLGVQPVYDLGVATVHNFVLANGLVASNCFNKSHSTAYGYVTFQTAYLKANFPVEYMAALLTVNSGNADKVQ 80
gi 218248458   1 MVKIVSYRSLGKQFVYDIGVAQDHNFLLANGSIASNCFNKSHSTAYAYVTYQTAYLKANYPVEYMTALLTASSDNQDKVE 80
gi 172039636   1 MVKIIGRQSLGVQKVYDIGVEKEHNFLLHNGLIASNCFNKSHSTAYAYVTYQTAYLKANYPVEYMTALLTASSDNQDKVE 80
gi 218441796   1 MVKIISRQSLGIQPVYDIGVEKDHNFLISDGLIASNCFNKSHSTAYAYVTYQTAYLKANYPVEYMTALLTASSDSQEKIE 80
gi 284928952   1 MTKITSRKSLGIHEVFDIGLEKDHNFLLDNGFIASNCFNKSHSTAYAYITYQTAYLKANYPVEYMAALLTANSDNQDKIE 80
gi 22299612    1 -MKIVGRRLMGWQAVYDIGLAADHNFVLANGAIAANCFNKSHSTAYGYVTYQTAFLKANFPVEYMAALLTANSGDQDKVQ 79
gi 158333930   1 MVKIIQRRSLGLQSVYDIGLAQDHNFVMANGWVAANCFNKSHSTAYGYVTYQTAYLKANYPVEYMAALLTANSGDQDKVQ 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329834   81 KYRENCQKMGITVEPPDINRSQRHFTPLGEAILFGLSAVRNLGEGAIEQIITARDNSEEkrFKSLADFCTQV-----DLR 155
gi 166366494  81 KYRENCQKMNIDVEPPDINRSQKHFTPIGRKILFGLSAVRNLGENAIEAILKAREATGGk-FTSLGDFCERV-----DLR 154
gi 170078979  81 KYRENAERMGILVLPPDINESDLDFKPVGQGIRFGLSAVQNLGENAINAILAAREAGP---FLSLSDLCSRL-----DLR 152
gi 56750961   81 KYIANCAAMGIEVLPPDINRSGVDFTPTGDRILFGLSAIRNLGLGAIESILAARDVGGP--FLSLADLCDRV-----DTG 153
gi 218248458  81 KYRENCQKMGIEVEPPDINRSQKHFTPVGEHILFGLSAVKNLGEGAIDNILKAREDEGN--FTSLADFCSRV-----DLR 153
gi 172039636  81 KYRENCQKMGIDVLPPDINRSQKDFTPVGKQILFGFSAVRNLGEGAIDNILKAREEAEGq-FESLADFCCRV-----DLR 154
gi 218441796  81 KYRENCQKLNIDVEPPDINRSQKDFTPIKEKILFGLSAVRNLGENAIENILKARQEAGGk-FESLADFCSRV-----DLR 154
gi 284928952  81 KYRENCQKMGIQVLPPDISLSLKDFTPLENQILFGLSAVRNLGEGAIDSILKARIQLNTk-FNSLADFCSNT-----DSR 154
gi 22299612   80 RYIATCLSMGIEVLPPDVNRSDIDFTPVGNKILFGLSAVRNVGQGVIEAILQARAEGGA--FQSLADFCERVpraggDSR 157
gi 158333930  81 KYIATALSMGIEVEPPDINRSGVDFTPLDKNILFGLSAVRNLGQGAIEAILAARDEDGG--FESLAELCDRV-----DPR 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329834  156 VVNRRAIETLIMAGAFDGVQS--NRNQLLHDLELVIAWAQKRAKEKETGQLNIFDSLTAGESIKAkeaaNNGFEQEPSAP 233
gi 166366494 155 VINKRALETLIYCGAFDKIQP--NRHQLIEDLELVVAWAQKRTKEKESGQMNIFDMLGGSTENKQ----ESEFEQSPSAT 228
gi 170078979 153 VVNRRALETLITCGGLDSLHD--NRQAMLKGLDLMMDWAQLKAKEKASGQTNLFESLGDTAA---------AFDEAPVLP 221
gi 56750961  154 SLNRRAMESLIHAGALDVLETgaNRQQLVADLPLVIDWANSRAKDRASGQGNLFDMLGSNDSNSS------PLDTAPKAP 227
gi 218248458 154 VVNKRALETLIYCGAFDKVQN--NRKQLINDIELVTAWAQKRAKEKESGQLNLFDLVGNSTSQNGa--sNSDFEQAPSSP 229
gi 172039636 155 SVNKRALETLIYAGAFDAIYP--NRKQLINDLELVVPWAQKRTKEKESGQLNIFDLMSGNTTESTe--aNTDFKQAPSAS 230
gi 218441796 155 IVNRRALETLIYCGAFDQIND--NRHQLIEYLDIVIPWAQKRNKEKESGQLNIFDALLENIENKNd--nEVVFDQAPNLP 230
gi 284928952 155 TVNKRALETLIYSGAFDSVSN--NRKQLINDLDLVISWAQKKAKDKESGQLNLFDLITNNADNSNl---DLEYEDVPSSP 229
gi 22299612  158 ILNRRALESLIACGAMDSLHPqrNRNQLMQDLPLVLEWALARAKDRAVGQVNLFDMLAGDSSNES----KGSYDPAPSAP 233
gi 158333930 154 VVNRRALEALIYSGALDAFDT--NRNQLVHDLELILEWAQSRAKDRAIGQGNLFDIMGGEGDAPT------SLETAPKAE 225
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329834  234 PVAEFSLQEKLQLEKEHLGFYVSEHPLKSVQRS-ARLLSPINLVDLDQYKVRQKVSAVAILVAVKKIITKKnGQPMAFLT 312
gi 166366494 229 AVEDFSLQEKLKLEKEHLGFYVSEHPLKALQRA-AQVLSPINLADLEEHKTRKKVSAIVLLNAVKKIMTKK-GTPMAFLT 306
gi 170078979 222 KVADLTLEEKLRQEKELLGFYVSEHPLEKLRSTiSPILSPISLTAIANHINK-KVSAVAILTDMRKIFTKAnNEPMAFIQ 300
gi 56750961  228 AVPDYSPDEKLKLEKELLGFYLSDHPLKVVQEP-ARLLAPASISDLEDYCDRGLISTIALLTEVKPVVTKK-GDRMAILR 305
gi 218248458 230 AVADFPLPERLKLEKEHLGFYVSEHPLKSIKKA-AAILSPINLSELEEQKSKQKISAVVMVNTIKKIVTKQ-GKNMAFLT 307
gi 172039636 231 SVEDYSLQDKLKLEKEHLGFYVSEHPLTAVKKA-AKILSPINLNEMGEQKAKTKVSAVIMVNEVKQYTTKK-GDQMAFLV 308
gi 218441796 231 SVADYSLDEKLKLEKEHLGFYVSEHPLNHILKK-AHVLSPVNLNELETQNSRKLISVVVMINSVKKITTRE-GKPMAFVG 308
gi 284928952 230 SVEDFSLQDKLKFEKEYLGFYISEHPLRIIEEP-VSILSPVSFDEIIVQKAKRNITILSTIAEIKEYTTKK-GDQMAFLV 307
gi 22299612  234 PVDDLPDTEKLRQEKDLLGFYVSNHPLKDIHRP-AAMIAPISLANLEQHTGQGVVSVIALLTGLKSITTKR-GERMAIVQ 311
gi 158333930 226 PVEDFQESEKLKLEKEILGFYISNHPLREIERP-ARLMAPISLANLEEQPEKTTVSAIVLLTEVKPIITKK-GDRMAIVQ 303
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329834  313 LEDMSGQSEAVVFPSNYERLQDVLIEGSQQMIWGKVDRR--DDQYQLIVEDLEPVEEVKMVMLDLTPQEIANTSTQARLK 390
gi 166366494 307 LEDASGQSEAVIFSDSYERLQKLLVEEATLMVWGKVDRR--DDRVQLIIEDAEPIETIKMVMVNLSLQDVVNQNRQNLLK 384
gi 170078979 301 LEDISGQVEGIVFPRTYQKVEQLLQLDSRVIVWGKVQQK--EDRTQLIVDDLEPIEEVRMLMIRLSPSELHHTQSQQRLK 378
gi 56750961  306 IEDLSGNTEAVVFPRSYERIGHYIEADARLMLWGKVDRR--DDQVQFIIEDAEPIDHVRLVLVELSVEQASDIVQQQRLK 383
gi 218248458 308 LEDISGQLEAVVFSDAYEKIYDLLVEDARLIVWGKVDRR--DDKVQLIVEDAETIDKLRMIMVRLSPQQALDRVSQSSLR 385
gi 172039636 309 LEDGSAQVDAVCFPESYKRIREVLIEDSRLIVWGKVDYR--DDKVQLIVEDAEPVETVRMVMVNLSLEQAINQVSYHSLK 386
gi 218441796 309 LEDTTAQVEGILFPSAYPRVQEVLSVESPLIMWGKVQKNkdEDKIQLIIEDAEPVEKVKLVMINLSIQEAMNVDRQTTLK 388
gi 284928952 308 LEDTSRHIEGVCFPKSYKKIKNVLTKDSVLIIWGKVDFR--DDKVQVIIEHAQDIDSMRIVIIDLSLEQATNKISCHNLK 385
gi 22299612  312 LEDLTGQAEAVVFPKAYERIHGQLQLDHRLLLWGTLEMR--DDRPQLLIEDAEPLEEVKLVLVDLPVEQAGDIQAQSRLS 389
gi 158333930 304 MEDLSGKAEGVVFPRSFERIGEYIETDLRLMIWGKVDRR--DDRIQIIVEDAEPIEEVKLVMVEIPAQDAGNIQQQQRLK 381
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 16329834  391 QILqsHAPQ-KEQMKIPVVACINEGPTKHFIRFGENYWVNDYGTAVASLQELGFRARLEPLLPQ 453
gi 166366494 385 SIL--QSGD-KQKAKVPVIATIGAGTQRQFVRLGQNYWVEDDNSVVESLKVAGFLANSAPLINH 445
gi 170078979 379 QILsqQAGDkKKRGRIPVIVIVGRGGDRTFIRLGQDYWVEDDHQALLALRQGGFHVYRENLIPQ 442
gi 56750961  384 ELLlqQKRE-EERSKVPVVAVIQAGSDRYFVRLGAQFRVEDPEEAVEALQAADFQARAEALLSP 446
gi 218248458 386 GILqeHSGD-KNQAKIPVIAIITTGQQQQFIRLGSNYWVQNELNAITSLNNAGFNAYTSPLMNN 448
gi 172039636 387 GILqeHSGD-KNKAKVPVIAIIGSGENRQLIRLGQDYWVQNDQSVIEALRKAHFNAYPTPLVSD 449
gi 218441796 389 ALLqnRNGE-KNTGKIPVLATIGKGKNRQIVRFGSHYWVQNEYSTIQDLTKAGFSAEAQPLS-- 449
gi 284928952 386 SILsgHAGK-NNQTKIPLFIFLQDKGNKKLIRLDESYWPNDEKLVINALNKVEFNSYSISLLEY 448
gi 22299612  390 EVLkqQAGE---MPKVPVVVKVTDGYHAQYVRLGPQFRVEDADRARHALTSAGFQAHASELLSL 450
gi 158333930 382 EILrqQAGE-ENAAKVSVIAKIKGDEKSQLVRLGSQFRVQNEHMAVQALASAGFRASSSVLVDL 444
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap