Conserved Protein Domain Family
PRK07314

?
PRK07314: PRK07314 
3-oxoacyl-(acyl carrier protein) synthase II; Reviewed
Links
?
Statistics
?
PSSM-Id: 235987
View PSSM: PRK07314
Aligned: 398 rows
Threshold Bit Score: 601.393
Threshold Setting Gi: 15827873
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
167646482   1 MRRVVVTGIGLLTPLGQGVDVTWKNILAGKSGANRISAFD--PTEYACQVACEVprvdgrggggpdvegafNPDLTMSPR 78 
41408096   11 YPSVVVTAVTATTSIAPDVESTWKGLLAGESGIHVLEDDYitKWDLPVRIGGHLk---------------ePIDERMSRL 75 
126435955  11 FPSVVVTAVEATTSLAADIESTWKGLLAGESGIRVLEDDFvtKWDLPVRIGGHLv---------------dNVDDHMTRI 75 
145223364  11 FPNVVVTAVTATTSIAPDIESTWKGLLAGESGIRILEDEFveKWDLAVKIGGHLk---------------ePLDPLMSRL 75 
108800332  11 FPSVVVTAVEATTSLAADIESTWKGLLAGESGIRVLEDDFvtKWDLPVRIGGHLv---------------dNVDDHMTRI 75 
161579549  11 YPSVVVTAVTATTSIAPDVESTWKGLLAGESGIHVLEDDYitKWDLPVRIGGHLk---------------ePIDERMSRL 75 
118471172  11 YPNVVVTAVTATTSIAPDIESTWKGLLAGESGIRVLEDEFvtKWDLPVRIGGHLv---------------dNIDDHMTRL 75 
118617003  11 YPSVVVTAVTATTSISPDIESTWKGLLAGESGIHVLDDEYltKWDLPVKIGGHLk---------------dPVDNHMGRL 75 
119869460  11 FPSVVVTAVEATTSLAADIESTWKGLLAGESGIRVLEDDFvtKWDLPVRIGGHLv---------------dNVDDHMTRI 75 
120404715  11 FPNVVVTAIEATTALAADIESTWKGLLAGESGIRILEDDFvdKWDLPVRIGGHLv---------------dDIDSHMTRI 75 
167646482  79 DQKRVDDFILYGIAAADEAVKDSGWVpetEEDRYRTGVILGSGIGGLSTIADTALELEAKGPRRISPFFISSALINLISG 158
41408096   76 DLRRMSYVQRLAKLLSTQLWETAGNP---ELDPDRFSVVVGTGLGGAERIVESYDLMNEGGPRKVSPLAVQMIMPNGAAA 152
126435955  76 DMRRMSYVQRMSKLVSGRLWETAGRP---EVDPDRFAVIIGTGLGGGEKIVETYDAMNEGGPRKVSPLAVQMIMPNGAAA 152
145223364  76 EMRRMSYVQRMSKYLGNQLWDSIGRP---EVDPDRFSVVIGTGLGGGEKIVETYDAMNEGGPRKVSPLAVQMIMPNGAAA 152
108800332  76 DMRRMSYVQRMSKLVSGRLWETAGRP---EVDPDRFAVIIGTGLGGGEKIVETYDAMNEGGPRKVSPLAVQMIMPNGAAA 152
161579549  76 DLRRMSYVQRLAKLLSTQLWETAGNP---ELDPDRFSVVVGTGLGGAERIVESYDLMNEGGPRKVSPLAVQMIMPNGAAA 152
118471172  76 DMRRMSYVQRMSKFLSKQLWENAGAP---EVDPDRFAVVIGTGLGGGEKIVETYDAMNEGGPRKVSPLAVQMIMPNGAAA 152
118617003  76 DIRRMSYVQRMAKFLSGQLWESAGSP---EVDPDRFTVVVGTGLGGAERIVESYDLMNEGGPRKVSPLTVQMIMPNGAAA 152
119869460  76 DMRRMSYVQRMSKLVSGRLWETAGRP---EVDPDRFAVIIGTGLGGGEKIVETYDAMNEGGPRKVSPLAVQMIMPNGAAA 152
120404715  76 DKRRMSYVQRMSKLLARRLWDNAGTP---EVDPDRFSVVIGTGLGGGEKIVETYDAMNEGGPRKVSPLAVQMIMPNGAAA 152
167646482 159 QVSIRYGFKGPNHAVVTACATGAHAIGDATRLIKYGDADVMVAGGAEAAVCKVGMAGFIACRAVSTDwNDTPEKASRPYD 238
41408096  153 VVGLQLGARAGVITPVSACSSGSEAIAHAWRQIVMGDADVAVCGGVEGPIDALPIAAFSMMRAMSTR-NDEPERASRPFD 231
126435955 153 VAGLELGARAGVITPVSACSSGSEAIAHGWRQIVMGDADFAVVGGVEGGIEALPIAAFSMMRAMSTR-NDDPAGASRPFD 231
145223364 153 VVGLELGARAGVITPVSACSSGSEGIAHAWRQIVMGDADIAVCGGVEGGIEALPIAAFSMMRAMSTR-NEDPEGASRPFD 231
108800332 153 VAGLELGARAGVITPVSACSSGSEAIAHGWRQIVMGDADFAVVGGVEGGIEALPIAAFSMMRAMSTR-NDDPAGASRPFD 231
161579549 153 VVGLQLGARAGVITPVSACSSGSEAIAHAWRQIVMGDADVAVCGGVEGPIEALPIAAFSMMRAMSTR-NDEPERASRPFD 231
118471172 153 VVGLELGARAGVITPVSACSSGSEAIAHAWRQIVMGDADFAVCGGVEGGIEALPIAAFSMMRAMSTR-NDDPQGASRPFD 231
118617003 153 VVGLQLGARAGVITPVSACSSGSEAIAHAWRQIVMGDADVAVCGGVEGPIEALPIAAFSMMRAMSTR-NDEPERASRPFD 231
119869460 153 VAGLELGARAGVITPVSACSSGSEAIAHGWRQIVMGDADFAVVGGVEGGIEALPIAAFSMMRAMSTR-NDDPAGASRPFD 231
120404715 153 VAGLELGARAGVITPVSACSSGSEAIAHAWRQIVMGDADFAVCGGVEGGIEALPIAAFSMMRAMSTR-NDDPAGASRPFD 231
167646482 239 AGRDGFVMGEGAGALVLEEYEHAKARGAKIYAEVIGYGLSGDAYHITAPSEDGDGGFRALSAAVKDAGIDVSEIDYVNAH 318
41408096  232 KDRDGFVFGEAGALMLIETEEHAKARGAKPLARLMGAGITSDAFHMVAPAGDGVRAGRAMTRSLELAGLSPKDVDHVNAH 311
126435955 232 KNRDGFVFGEAGAMMIIETEEHALARGAKPLARLMGAGITSDAFHMVAPAADGLRAGHAMKRAMETAGIDPKDVNHVNAH 311
145223364 232 KNRDGFVFGEAGALMVIETEEHALARGAKPLARLLGAGITSDAFHMVAPASDGQRAGSAMKRAMETAGLSPKDIDHVNAH 311
108800332 232 KNRDGFVFGEAGAMMIIETEEHALARGAKPLARLMGAGITSDAFHMVAPAADGLRAGHAMKRAMETAGIDPKDVNHVNAH 311
161579549 232 KDRDGFVFGEAGALMLIETEEHAKARGAKPLARLMGAGITSDAFHMVAPAADGVRAGRAMTRSLELAGLSPKDVDHVNAH 311
118471172 232 KDRDGFVFGEAGAMMIIETEEHAKARGAKPLARLMGAGITSDAFHMVAPAADGLRAGQAMKRAMETAGLDPKDIDHVNAH 311
118617003 232 KDRDGFVFGEAGALLLIETEEHAKARGAKPLARLMGAGITSDAFHMVAPAADGVRAGRAMQRSMELAGLSPTDIDHVNAH 311
119869460 232 KNRDGFVFGEAGAMMIIETEEHALARGAKPLARLMGAGITSDAFHMVAPAADGLRAGHAMKRAMETAGIDPKDVNHVNAH 311
120404715 232 KDRDGFVFGEAGVMMIIETEEHAKARGATPLARLMGAGITSDAFHMVAPAADGVRAGHAMKRAMETAGLSPKDISHVNAH 311
167646482 319 GTST-MADGIEAKAVERflgDHAKNVVMSSTKSMTGHLLGAAGAIEGIFSILAIRDQIAPPTINLDNPNVDVAMNLAPNK 397
41408096  312 GTATpIGDTAEANAIRV---AGCQEAAVYAPKSALGHSIGAVGALESVLTVLTLRDGVIPPTLNYETPDPEIDLDIVAGE 388
126435955 312 ATATpIGDTAEANAIRV---AGVEHAAVYAPKSALGHSIGAVGALESILTVLALRDGVIPPTLNYETPDPEIDLDVVAGE 388
145223364 312 ATSTsIGDVAEANAIRV---AGVEHAAVYAPKSALGHSIGAVGALESILTVLALRDGVIPPTLNYETPDPEIDLDVVAGE 388
108800332 312 ATATpIGDTAEANAIRV---AGVEHAAVYAPKSALGHSIGAVGALESILTVLALRDGVIPPTLNYETPDPEIDLDVVAGE 388
161579549 312 GTATpIGDTAEANAIRV---AGCQEAAVYAPKSALGHSIGAVGALESVLTVLTLRDGVIPPTLNYETPDPEIDLDIVAGE 388
118471172 312 ATATpIGDTAEANALRV---AGVEHAAVYAPKSALGHSIGAVGALESILTVLALRDGVIPPTLNYETPDPEIDLDIVAGE 388
118617003 312 GTATpIGDSAEANAIRV---AGFENAAIYAPKSALGHSIGAVGALESALTVLSLRDGVIPPTLNYETPDPEIDLDVVAGE 388
119869460 312 ATATpIGDTAEANAIRV---AGVEHAAVYAPKSALGHSIGAVGALESILTVLALRDGVIPPTLNYETPDPEIDLDVVAGE 388
120404715 312 ATATpIGDTAEANAIRV---AGVEHAAVYAPKSALGHSIGAVGALESALTVLALRDGVIPPTLNYETPDPEIDLDVVAGE 388
167646482 398 AVPMKIDVAVSNSFGFGGTNASVVFRKV 425
41408096  389 PRYGDYQYAINNSFGFGGHNVALAFGRY 416
126435955 389 PRYGDYQYAINNSFGFGGHNVALAFGRY 416
145223364 389 PRYGDYKYAINNSFGFGGHNVALAFGRY 416
108800332 389 PRYGDYQYAINNSFGFGGHNVALAFGRY 416
161579549 389 PRYGDYQYAINNSFGFGGHNVALAFGRY 416
118471172 389 PRYGEYKYAINNSFGFGGHNVALAFGRY 416
118617003 389 PRYGEFQYAINNSFGFGGHNVALAFGRY 416
119869460 389 PRYGDYQYAINNSFGFGGHNVALAFGRY 416
120404715 389 PRYGDYQYAINNSFGFGGHNVALAFGRY 416
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap