Conserved Protein Domain Family
PRK07310

?
PRK07310: PRK07310 (this model, PSSM-Id:102820 is obsolete)
aspartate aminotransferase; Provisional
Statistics
?
PSSM-Id: 102820
View PSSM: PRK07310
Aligned: 30 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29376870    1 MNVSNRAQQLTPSVTLAAAAKAKALKAKGVDVLSLTVGEPDFVTPKNIQKAAIASIEDGRASYYTPSGGIPELKQAIVSY 80
gi 125624794   2 KKCSDFVLKMDESVTLAAANRAKALKAQGRDIIDLTLGQPDFPTPKKIGQAAIEAINNGQASFYTQAGGLPELKKAVQHY 81
gi 116512709   2 KKCSDFVLKMDESVTLAAANRAKALKAQGRDIIDLTLGQPDFPTPKKIGQAAIEAINNGQASFYTQAGGLPELKKAVQHY 81
gi 157150679   1 MKLSNRVLKMEESVTLAAAARAKDLKAEGRDILSLTLGEPDFPTPKNIQQAAVAAIEDGKASFYTVTSGLPELKEAVVQY 80
gi 15901387    1 MKLSNRVLEMEESVTLAAGARAKALKAEGRDILSLTLGEPDFTTPKNIQDAAIASIRDGRASFYTVTSGLPELKAAVNSY 80
gi 125718198   1 MKLSNRVLKMEESVTLATAARAKALKAQGRDILSLTLGEPDFPTPKNIRDAAIAAVEDGRASFYTVTSGLPELKEAVVEY 80
gi 116516335   1 MKLSNRVLEMEESVTLAAGARAKALKAEGRDILSLTLGEPDFTTPKNIQDAAIASIRDGRASFYTVTSGLPELKAVVNSY 80
gi 15903442    1 MKLSNRVLEMEESVTLAAGARAKALKAEGRDILSLTLGEPDFTTPKNIQDAAIASIRDGRASFYTVTSGLPELKAVVNSY 80
gi 116627678   2 TKLSNRVLQMEESVTLAASARAKALKAKGRDILSLTLGEPDFVTPKNIQDAAIASIENGKASFYTVASGLPELKDAVSTY 81
gi 55820867    2 TKLSNRVLQMEESVTLAASARAKALKAKGRDILSLTLGEPDFVTPKNIQDAAIASIENGKASFYTVASGLPELKDAVSTY 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29376870   81 VEREYQLRYQPKQVIVTDGAKYALYLLFQAILNVGDEVIIPVPYWVSYGEQVKLAEGKPVFVSSTQEQSFKVSVAQLEAV 160
gi 125624794  82 WTRFYAYEIQTNEILITAGAKFALYAYFMATVDPLDEVIIPAPYWVSYVDQVKMAGGNPVIVEAKQENNFKVTVEQLEKA 161
gi 116512709  82 WTRFYAYEIQTNEILITAGAKFALYAYFMATVDPLDEVIIPAPYWVSYVDQVKMAGGNPVIVEAKQENNFKVTVEQLEKA 161
gi 157150679  81 FANYYGYEIKPNQVTVATGAKFSLYTFFMSVLDPSDEAIIPTPYWVSYGDQIQMAEGVPVFVQATEENDFKVTVDQLEAV 160
gi 15901387   81 FERFYGYSVASNQVTVAAGAKYSLYTFFMAVVNPGDEVIIPTPYWVSYGDQVKMAEGVPVFVSAKEDNHFKVTVEQLEAA 160
gi 125718198  81 FANYYGYTIQPNQVTVATGAKFSLYTFFMSVLDPGDEAIIPTPYWVSYGDQIKMAEGTPVFVQTTEENNFKVTVEQLEAA 160
gi 116516335  81 FERFYGYSVASNQVTVAAGAKYSLYTFFMAVVNPGDEVIIPTPYWVSYGDQVKMAEGVPVFVSAKEDNHFKVTVEQLEAA 160
gi 15903442   81 FERFYGYSVASNQVTVAAGAKYSLYTFFMAVVNPGDEVIIPTPYWVSYGDQVKMAEGVPVFVSAKEDNHFKVTVEQLEAA 160
gi 116627678  82 MENFYGYTVKHSEIVVGTGAKFILYAFFATVINPGDEVIIPTPCWVSYVDQVKMVEGVPVTFQTTEANHFKATVEQLEAA 161
gi 55820867   82 MENFYGYTVKHSEIVVGTGAKFILYAFFATVINPGDEVIIPTPCWVSYVDQVKMVEGVPVTFQTTEANHFKATVEQLEAA 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29376870  161 RTDKTKAIILNSPSNPTGVIYTEEELRQIGEWAVAHNILIIADDIYGRLVYNGHRFTPIATISEAIRQQTIIINGVSKTY 240
gi 125624794 162 RTSKTKILLLNSPSNPTGMIYSKEELTAIGEWAVAHDLLILADDIYHRLVYNGAEFTAISSLSDEIRNRTTVINGVSKTF 241
gi 116512709 162 RTSKTKILLLNSPSNPTGMIYSKEELTAIGEWAVANDLLILADDIYHRLVYNGAEFTAISSLSDEIRNRTTVINGVSKTF 241
gi 157150679 161 RTDKTKVLVLNSPSNPTGMIYTAEELLAIGNWAVEHDILILADDIYGRLVYNGNEFTPISSLSEAIRKQTVVINGVSKSY 240
gi 15901387  161 RTDKTKVLVLNSPSNPTGMIYTREELLAIGNWAVENDILILADDIYGRLVYNGHEFTPISSLSEAIRKQTVVINGVSKTY 240
gi 125718198 161 RTDKTKVLVLNSPSNPTGMIYTADELRAIGNLAVEHDILILADDIYGRLVYNGNTFTPISSLSEEIRKQTVVINGVSKSY 240
gi 116516335 161 RTDKTKVLVLNSPSNPTGMIYTREELLAIGNWAVENDILILADDIYGRLVYNGHEFTPISSLSEAIRKQTVVINGVSKTY 240
gi 15903442  161 RTDKTKVLVLNSPSNPTGMIYTREELLAIGNWAVENDILILADDIYGRLVYNGHEFTPISSLSEAIRKQTVVINGVSKTY 240
gi 116627678 162 RTEKTKVVLLNSPSNPTGMIYSKEELQSIGDWAVEHDILILADDIYGRLVYNGNTFTPISSLSDAIRKQTIVINGVSKTY 241
gi 55820867  162 RTEKTKVVLLNSPSNPTGMIYSKEELQSIGDWAVEHDILILADDIYGRLVYNGNTFTPISSLSDAIRKQTIVINGVSKTY 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29376870  241 AMTGWRIGFAVGDEKIIQAMTQLASQSTSNPVAVSQYAAIEALTGEQSTVEDMRQAFEKRLNHIYPKVAALPGVSLIKPE 320
gi 125624794 242 AMTGWRIGLAVGDPEIIAAMTKIASQTTSNPTAVAQYAAIEAFEENDKSFEKMHAAFEERLNKIYLQLSEVPGFELVKPN 321
gi 116512709 242 AMTGWRIGLAVGAPEIIAAMTKIASQTTSNPTAVAQYAAIEAFEENDKSFEKMHAAFEERLNKIYLQLSEVPGFELVKPN 321
gi 157150679 241 SMTGWRIGYAVGEPEIIAAMSKVAGQTTSNPTTVAQYAAIEALTGSQETVEIMRQAFEERLNTIYPLLAQVPGFEVIKPQ 320
gi 15901387  241 AMTGWRIGYAVGEADIIAAMSKIAGQTTSNPSAVAQYAAVEALSGEQDTVESMRQAFEERLNTIYPLLAEVPGFEVVKPQ 320
gi 125718198 241 SMTGWRIGYAVGEPEIIAAMSKIAGQTTSNPTAAAQYAAIEALTGSQETVETMRQAFEERLNTIYPLLAQVPGFEVVKPQ 320
gi 116516335 241 AMTGWRIGYAVGEADIIAAMSKIAGQTTSNPSAVAQYAAVEALSGEQDTVESMRQAFEERLNTIYPLLAEVPGFEVVKPQ 320
gi 15903442  241 AMTGWRIGYAVGEADIIAAMSKIAGQTTSNPSAVAQYAAVEALSGEQDTVESMRQAFEERLNTIYPLLAEVPGFEVVKPQ 320
gi 116627678 242 AMTGWRVGFAVGEPEIISGMAKIISQTTSNLTSVSQYAAIEALTGDQSSIEEMRKAFEERLNTIYPLLAEVPGFEVIKPQ 321
gi 55820867  242 AMTGWRVGFAVGEPEIISGMAKIISQTTSNLTSVSQYAAIEALTGDQSSIEEMRKAFEERLNTIYPLLAEVPGFEVIKPQ 321
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 29376870  321 GAFYLFPNVKKTLEICGYDNVTNWVEDLLQEAHVALVTGEGFGAPEHVRMSYATDLMTLEKAIERMNDFIEK 392
gi 125624794 322 GAFYLFPKVTKAMAMKGYTDVTDFTTAILEEAGVALVTGAGFGSPENVRLSYATSLETLEAAVTRLKDWMND 393
gi 116512709 322 GAFYLFPKVTKAMAMKGYTDVTDFTTAILEEAGVALVTGAGFGSPENVRLSYATSLETLEAAVTRLKDWMND 393
gi 157150679 321 GAFYLFPNVKKAMEMKGFTDVTAFTTAILEEVGVALVTGAGFGAPENVRLSYATDLETLKEAVQRLKQFMER 392
gi 15901387  321 GAFYLFPNVKKAMEMKGYTDVTDFTTVILEEAEVALVTGAGFGAPENVRLSYATDLDTLKEAVERLKAFMGS 392
gi 125718198 321 GAFYLFPNVKKAMEMKGYTDVTEFTTAILEEVGVALVTGAGFGAPENVRLSYATDLDTLKEAVQRLQQFMES 392
gi 116516335 321 GAFYLFPNVKKAMEMKGYTDVTDFTTAILEEAEVALVTGAGFGAPENVRLSYATDLDTLKEAVERLKAFMGS 392
gi 15903442  321 GAFYLFPNVKKAMEMKGYTDVTDFTTAILEEAEVALVTGAGFGAPENVRLSYATDLDTLKEAVERLKAFMGS 392
gi 116627678 322 GAFYLFPNVKKAMEIKGYTDVNDFTNAILEEAEVALVTGAGFGAPENIRLSYATDLDILKEAVRRIKAFMEK 393
gi 55820867  322 GAFYLFPNVKKAMEIKGYTDVNDFTNAILEEAEVALVTGAGFGAPENIRLSYATDLDILKEAVRRIKAFMEK 393
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap