Conserved Protein Domain Family
PRK07261

?
PRK07261: PRK07261 
topology modulation protein; Provisional
Statistics
?
PSSM-Id: 180911
View PSSM: PRK07261
Aligned: 37 rows
Threshold Bit Score: 278.139
Threshold Setting Gi: 187933921
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125717863   1 MKIAIIGYSGSGKSTLAAQLSNHYSIPKLHMDRLQFQPGWKDSDRDWMSKQMDNFLSKNTdWIIDGNYSWCFYERRMAEA 80
gi 22538180    1 MKIAIIGYSGSGKSTLARKLGNYYNCNVLHLDSIHFAPNWEERKYDDMIDDVSNMLEKRT-WIIEGNYKKLLYQERLADA 79
gi 25012039    1 MKIAIIGYSGSGKSTLARKLGNYYNCNVLHLDSIHFAPNWEERKYDDMIDDVSNMLEKRT-WIIEGNYKKLLYQERLADA 79
gi 139474472   1 MKIAIIGHSGSGKSTLARFLGQHYHCEVFHLDQLHFSSNWQERSDHDMIADLSTCLLKQD-WIIEGNYANCLYEERMSEA 79
gi 50915054    1 MKIAIIGHSGSGKSTLARFLGQHYHCEVFHLDQLHFSSNWQERSDHDMIADLSTCLLKQD-WIIEGNYANCLYEERMSEA 79
gi 19746898    1 MKIAIIGHSGSGKSTLARFLGQHYHCEVFHLDQLHFSSNWQERSDHDMIADLSTCLLKQD-WIIEGNYANCLYEERMSEA 79
gi 209560134   1 MKIAIIGHSGSGKSTLARFLGQHYHCEVFHLDQLHFSSNWQERSDHDMIADLSTCLLKQD-WIIEGNYANCLYEERMSEA 79
gi 94989336    1 MKIAIIGHSGSGKSTLARFLGQHYHCEVFHLDQLHFSSNWQERSDHDMIADLSTCLLKQD-WIIEGNYANCLYEERMSEA 79
gi 94993225    1 MKIAIIGHSGSGKSTLARFLGQHYHCEVFHLDQLHFSSNWQERSDHDMIADLSTCLLKQD-WIIEGNYANCLYEERMSEA 79
gi 94991278    1 MKIAIIGHSGSRKSTLARFLGQHYHCEVFHLDQLHFSSNWQERSDHDMIADLSTCLLKQD-WIIEGNYANCLYEERMSEA 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125717863  81 DQIIFLNFSRWNCLYRAFKRYLKYRNRTRESMAPGCPEKFDWEFICWVLWKGRRQPALERYKRIRQTFPQKFYELKNQKE 160
gi 22538180   80 DEIIFFDFNRFNCLWRAFKRYCKFRGKTRPDMANGCPEKLDFEFISWILKDGRSDKQKSNYKQVVEDYPQKIKILKHQRD 159
gi 25012039   80 DEIIFFDFNRFNCLWRAFKRYCKFRGKTRPDMANGCPEKLDFEFISWILKDGRSDKQKSNYKQVVEDYPQKIKILKHQRD 159
gi 139474472  80 DYIIYVNFSRFHCVYRAFKRYLNYRGKTRPDMADNCQEKFDVAFVKWILLDGRSRNQLKKYQSVVQKYSHKTIVLTNQKQ 159
gi 50915054   80 DYIIYVNFSRFHCVYRAFKRYLNYRRKTRPDMADNCQEKFDVAFVKWILLGGRSRNQLKKYQSVIQKYPHKTIVLTNQKQ 159
gi 19746898   80 DYIIYVNFSRFHCVYRAFKRYLNYRGKTRPDMADNCQEKFDVAFVKWILLGGRSRNQLKKYQSVVQKYSHKTIVLTNQKQ 159
gi 209560134  80 DYIIYVNFSRFHCVYRAFKRYLNYRGKTRPDMADNCQEKFDVAFVKWILLDGRSRNQLKKYQSVVQKYSHKTIVLTNQKQ 159
gi 94989336   80 DYIIYVNFSRFHCVYRAFKRYLNYRGKTRPDMADNCQEKFDVAFVKWILLDGRSRNQLKKYQSVVQKYSHKTIVLTN--- 156
gi 94993225   80 DYIIYVNFSRFHCVYRAFKRYLNYRGKTRPDMADNCQEKFDVAFVKWILLDGRSRNQLKKYQSVVQKYSHKTIVLTN--- 156
gi 94991278   80 DYIIYVNFSRFHCVYRAFKRYLNYRGKTRPDMADNCQEKFDVAFVKWILLGGRSINQLKKYQSVIQKYPHKTIVLTNQKQ 159
                        170
                 ....*....|..
gi 125717863 161 LTNFLQNLKTSE 172
gi 22538180  160 LDQYLKELPVAS 171
gi 25012039  160 LDQYLKELPVAS 171
gi 139474472 160 LSHYMNTIN--- 168
gi 50915054  160 LSHYMNTIN--- 168
gi 19746898  160 LSHYMNTIN--- 168
gi 209560134 160 LSHYMNTIN--- 168
gi 94989336      ------------
gi 94993225      ------------
gi 94991278  160 LSHYMNTIN--- 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap