Conserved Protein Domain Family
PRK07228

?
PRK07228: PRK07228 
N-ethylammeline chlorohydrolase; Provisional
Statistics
?
PSSM-Id: 180895
View PSSM: PRK07228
Aligned: 23 rows
Threshold Bit Score: 717.549
Threshold Setting Gi: 222480611
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 167630730   5 IIIKDALIVTMNQQRQVIRGDLAICDGVISSIRPGGDLDSvgesspasdrqtaffADRIIDAQGRMVIPGIIQGHIHLCQ 84
gi 55376787    1 --MLLTGTVVSDSETVLQDGAVVVSGDRIEAVGSRAELESq--------------YADHEHQSYDVLLPGLVGGHIHSVQ 64
gi 15790271    1 MTLLTADTVVQDADRVLQDGAVVVVDDRITAVGDRAALADa--------------HPDHERIDVDVLAPGLVGAHVHSVQ 66
gi 169236002   1 MTLLTADTVVQDADRVLQDGAVVVVDDRITAVGDRAALADa--------------HPDHERIDVDVLAPGLVGAHVHSVQ 66
gi 292657041   1 --MLLAGTVVVDASTIIEEGAVVVDGDRIVAVGAHADLTDr--------------YPNHERREFGIVAPGLVGGHVHSVQ 64
gi 289582777   1 --MLLSGTVVADADTVIADGAVVVADDEIVAVGDRSTCLEe--------------YPEHEHHACDVLAPGTVGGHVHSVQ 64
gi 284167168   1 --MLLAGTVIVDSSTVINDGAVVVTDSIIEAVGEYAVLADr--------------YPDHDQREYDVLLPGLVGGHIHSVQ 64
gi 257388127   1 --MRLTGTVVADADTVYEDGAVVTSGDEIVAVGDRQRLVRq--------------YPDHDSRSFDIVAPGLVGSHVHSVQ 64
gi 110667994   1 --MKLSGDIVQNSSRIIPDGAVVVEDTEIIAVGDREDICEq--------------YPDHPEQHYDIIMPGMVGGHIHSVQ 64
gi 300711133   1 --MLLTGTVVVDSSTVLEDGAVVTDGGEIVAVGTAADLIDr--------------YPDHERRNYDMLVPGLVGAHVHSVQ 64
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 167630730  85 TLFRGQADDLELLDWLKLRIWPLEGAHDAESLYTSACLGIGEMFRCGTTAIVDMATVHHTESVFQAIVDSGIRALSGKCM 164
gi 55376787   65 SLGRGIADDTELLDWLFDYILPMEASLTAEEMEVAAKLGYLEMIESGTTTCIDHLSVAHADRAFEAAGEIGIRGVLGKVL 144
gi 15790271   67 SLGRGIADDQELLDWLFDHVLPMEAGLDAAEMRAAADLAYLEFVESGTTGVVDHLSVDHAGEAFGAAADSGVRARLGKVL 146
gi 169236002  67 SLGRGIADDQELLDWLFDHVLPMEAGLDAAEMRAAADLAYLEFVESGTTGVVDHLSVDHAGEAFGAAADSGVRARLGKVL 146
gi 292657041  65 SLGRGIADDTELLDWLFDHVLPMEAGLDAEGMRVAAELGYLECIESGTTTVVDHLSVRHAEEAFEAAGEMGIRGRIGKVL 144
gi 289582777  65 SLGRGIADDTELLEWLSEYVLPMEASLSADGMRVAAELGYLELIESGTTTCIDHLSVAHADEAFEAARELGIRGRLGKVL 144
gi 284167168  65 SLGRGIADDTELLDWLFDYILPMEASLSAEEMEVAAKLGYLEMIESGTTTCVDHLSVDHADRAFQAAGEIGIRGVLGKVL 144
gi 257388127  65 SLGRGIADDEALLDWLFDHVLPMEAAMDAEQMRTAATLGYMECLASGVTTVVDHLSVAHADQAFEAAGEIGIRGLLGKVL 144
gi 110667994  65 SLGRGISDDTELIDWLYDYILPMEATLTANEMEIAAKLGYLELIETGTTTAIDHLSVAHAEQAFEAAGEMGIRGVLGKVL 144
gi 300711133  65 SLGRGIADDTALLEWLYEHVLPMEAAMNGEAMEVAALLGYLELIESGVTTCIDHLSVSHADRAFEAAGEVGIRGLFGKVL 144
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 167630730 165 MDrgQDVPVTLMEQREESLRESVDLLEKWHGKGDGRLHYAFAPRFAISCSEELLLEVGDLARRY-GVMIHTHASESRGEI 243
gi 55376787  145 MD--QRSPDGLLEDTQAALDESERLIQQYHGAYNDRIRYAVTPRFAVSCSEACLRGVRELVDKYdGVRIHTHASENQSEI 222
gi 15790271  147 MD--KDSPDGLQEDTDAALAETEALIREWDGACDGRIQYAITPRFAVSCTEACLRGCRALADEY-GVRIHTHASENQGEI 223
gi 169236002 147 MD--KDSPDGLQEDTDAALAETEALIREWDGACDGRIQYAITPRFAVSCTEACLRGCRALADEY-GVRIHTHASENQGEI 223
gi 292657041 145 MD--TNAPEGLQEDTDAGLAESERLIERYHDSFDGRIQYAVTPRFAVTCSEACLRGARDLADRYdGVRIHTHASENRSEI 222
gi 289582777 145 MD--KESPPGLLEDTDEALAESERLIQKYHGAADGRIRYAVTPRFAVSCTEECLRGSRELADAYdGVTIHTHASENRGEI 222
gi 284167168 145 MD--RRSPTNLLEDTSDALAETERLIEEYHGSFDDRIRYAVTPRFAVSCTEECLRGARELADEYeGVRIHTHASENQSEI 222
gi 257388127 145 MD---YDAGALQEDTDAALAESERLIERYHGAFDDRIRYAVTPRFAVSCTERCLRGARDLADAYdDVRIHTHASENRDEI 221
gi 110667994 145 MD--QRSPGGLLEETQDALAETEQLIQKYHRSHDDRIRYAVTPRFAVSCTEECLRRTRELADAYdGVRIHTHASENQNEI 222
gi 300711133 145 MD--KDAPEGLREDTDEALAESERLIERYDGLNNGRIRYAVTPRFAVSCTEPCLRGARDLAEEY-GVRIHVHASENREEC 221
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 167630730 244 AIVQEERKMRNVLYFDHLGMAGDNLILAHCIWLDEAELDLIEQRRIKVSHCPSCNLKLGSGVAPIPELIRRNVAVSIGAD 323
gi 55376787  223 ETVKEDTGMRNIHWLDEVGLTGEDVVLAHCVWTDESEREVLAETGTHVTHCPSSNMKLASGIAPIWDYRDRGINVAIGND 302
gi 15790271  224 ETVETETGKRNIHWLDDVGLTGEDVVLAHCVWTDDSERALLAETGTHVTHCPSSNMKLASGVAPVADYRERGINVALGTD 303
gi 169236002 224 ETVETETGKRNIHWLDDVGLTGEDVVLAHCVWTDDSERALLAETGTHVTHCPSSNMKLASGVAPVADYRERGINVALGTD 303
gi 292657041 223 ETVEDETGMRNIHWLDEVGLTGDDVVLAHCVHTDDSERDVLAETGTHVTYCPSSNMKLASGIAPIPDYLDRGINVALGND 302
gi 289582777 223 AAVEEETGQRNIHWLDEVGLTGEDVVLAHCVWTDEDEREVLAETGTNVTYCPSSNMKLASGVAPVLDYLDRGINVALGND 302
gi 284167168 223 ETVKEDTGMRNIHWLDEVGLTGEDVVLAHCVWTDESERQVLEETGTHVTHCPSSNMKLASGIAPVWDYLERGINVALGND 302
gi 257388127 222 QTVEDRTGMRNVEWLDEVGLTGPDVTLAHCVWTDETERAILAETDTTVVHCPSSNMKLASGIAPVEAYLQRGITVALGND 301
gi 110667994 223 KTVEADTGYRNIHWLDEVGLTGEDVVLAHCIWTNESERELLAETGTHVTHCPSSNMKLASGIAPVVDYLDKGINIALGND 302
gi 300711133 222 AVVREETGMDNIEWLDEVGLTGEDCVLAHCVHTSEREREILAETGTHVVHCPSSNMKLASGVAPVEAYVDRGINVALGND 301
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 167630730 324 GAPCNNNLDPFTEMRTAALIQKA-LHGPTAMPAWQVFELATLGGAQVMGMaDRIGSLEVGKRADLAMLDLNHLHCAPIEg 402
gi 55376787  303 GPPCNNTLDAFTEMRQASLLQKVdQLDPTVTPAAEIFEMATRNGAKAAGF-EELGAIREGWRADIVGLDTDLTRATPLH- 380
gi 15790271  304 GPPCNNTLDGFAEMRQASLLGKVdALDPTALPARSVFEMATHNGAKAAGF-ENVGRIAEGWTADLVGLSTDAARSTPIH- 381
gi 169236002 304 GPPCNNTLDGFAEMRQASLLGKVdALDPTALPARSVFEMATHNGAKAAGF-ENVGRIAEGWTADLVGLSTDAARSTPIH- 381
gi 292657041 303 GPPCNNTLDPFTEMRQASLLQKVdALDPTSTPAATVFEMATRNGAKAAGF-DRVGELREGWKADIVGIDADRTRATPLH- 380
gi 289582777 303 GPPCNNTLDPFTEMRQASLLQKVdQLDSEALPADTVFEMATVNGAQAAGF-ERVGKLREGWKADIIGLETDITRATPLH- 380
gi 284167168 303 GPPCNNTLDPFTEMRQASLLQKVdRLDPTATPASEIFEMATINGAKAAGF-DRLGAIREGWRADIVGIRTDITRATPLH- 380
gi 257388127 302 GPPCNNTLDPFTEMRQAALLAKVgELDATALPAATAFRMATEHGGQATGF--DVGVLAPGRPADVIGLATDTARATPVH- 378
gi 110667994 303 GPPCNNTLDPFTEMKQASVLQKVdNLDPTVAAMEDIFEMATINGAKAAGF-DRLGELKPGWRADIIGLSTDTTRGTPLY- 380
gi 300711133 302 GPPCNNTLDPYTEMRQASLLGKVdSLDPTTLPARTVFEMATVNGARAAGF-DRVGTLREGWRADVVGLSTDLTRATPIH- 379
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 167630730 403 aDVYTQLVYQARGSDVVLTMVDGRIVYEEGKLTTIDEKDLLRDASEAIVRVVRRAGIVR 461
gi 55376787  381 -DVLSHLVFAAHGDDVRFTMVDGNVLMEQGEVTTIDADAVRSQASTMGLEMDLEDARKS 438
gi 15790271  382 -DPYSHLVYAAHGDDVTLTMVAGDVLYRDGAHVRMDAPAIRERAREFAAEL-------- 431
gi 169236002 382 -DPYSHLVYAAHGDDVTLTMVAGDVLYRDGAHVRMDAPAIRERAREFAAEL-------- 431
gi 292657041 381 -DVLSHLVFAAHGDDVVFTMVDGDVLYDEGEHVRADADGIRKRARAVADGLDSAPTSD- 437
gi 289582777 381 -DVLSHLTFAAHGDDVQFTMVDGEVLMREGEVLVADAADIRARAREFAAELHVAP---- 434
gi 284167168 381 -DVLSHLVFGAHGEDVVFSMVDGNVLMEDGEVTTVDAETVRRRADEIGLSLESHREAAK 438
gi 257388127 379 -DPLSHLVFAAHGDDVRFTMVDGEVVYDDGSFANVDGAAVRADARRHADSIYAEISSKD 436
gi 110667994 381 -DVLSYLVFAARGNDVEFTMVNGNILMENGTVTIADADSIRQSATDVAESLDISDARAD 438
gi 300711133 380 -DPLSHLVFAAHGDDVRFTMVDGEVLYDDGEITTVDARRVRARANELAEMIV------- 430
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap