Conserved Protein Domain Family
PRK07204

?
PRK07204: PRK07204 
3-oxoacyl-(acyl carrier protein) synthase III; Reviewed
Links
?
Statistics
?
PSSM-Id: 235964
View PSSM: PRK07204
Aligned: 18 rows
Threshold Bit Score: 571.009
Threshold Setting Gi: 289163889
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
226314262   2 ERKIKILGTGKYLPTRRVTAAELEEKLGLAAGWVEKKSGVSVRHFVT-NETAAQMGAIAARRALEAAGLSLHEIDCIVCA 80 
54297551    1 MSSAKIIGMGKYLPANIVFSSDLDKKLNLPEGSVQKKSGLVSRHFARvNETTSYMASQAALHAVEQAGITLAEIDAIIGA 80 
148359166   1 --------MGKYLPANIVFSSDLDKKLNLPKGSVQKKSGLVSRHFARvSETTSYMASQAALHAVEQAGITLAEIDAIIGA 72 
49186023    2 KRYISIKGIGTYLPKRKVDSLEIDQMLDVPEGWTLKKAGVKTRYFVD-GETSSYMGAEAAKKAVEDAKLTWDDIDCIICG 80 
47528539    2 KRYISIKGIGTYLPKRKVDSLEIDQMLDVPEGWTLKKAGVKTRYFVD-GETSSYMGAEAAKKAVEDAKLTWDDIDCIICG 80 
227813961   2 KRYISIKGIGTYLPKRKVDSLEIDQMLDVPEGWTLKKAGVKTRYFVD-GETSSYMGAEAAKKAVEDAKLTWDDIDCIICG 80 
229604721   2 KRYISIKGIGTYLPKRKVDSLEIDQMLDVPEGWTLKKAGVKTRYFVD-GETSSYMGAEAAKKAVEDAKLTWDDIDCIICG 80 
218904365   2 KRYISIKGIGTYLPKRKVDSLEIDQMLDVPEGWTLKKAGVKTRYFVD-GETSSYMGAEAAKKAVEDAKLTWDDIDCIICG 80 
296107209   1 --------MGKYLPANIVFSSDLDKKLNLPKGSVQKKSGLVSRHFARvSETTSYMASQAALHAVEQAGITLAEIDAIIGA 72 
52841859    1 MSSAKIIGMGKYLPANIVFSSDLDKKLNLPEGSVQKKSGLVSRHFARvSETTSYMASQAALHAVEQAGITLAEIDAIIGA 80 
226314262  81 SGTAQQEIPCTAALIQEELQLSKSGIPCFDINATCLSFVTALDVMSCQMAVGIYERVLIISSEISSAGLNWEQKESCVLF 160
54297551   81 CGAGEQPIPCTAVLVQKQLGLDNSGIACFDINSTCLSFLTALDAASYMLSGGRFNRILIVSSDIPSFGLDWSDLETCTIF 160
148359166  73 CGAGEQPIPCTAVLVQKQLGLDNSGIACFDINSTCLSFLTALDAASYMLSGGRFNRILIVSSDIPSFGLDWSDLETCTIF 152
49186023   81 SGTIQQAIPSTASLIQEQLGLQHSGIPCFDINSTCLSFITALDTISYAIECGRYKNVVIISSEISSVGLNWGQNESSILF 160
47528539   81 SGTIQQAIPSTASLIQEQLGLQHSGIPCFDINSTCLSFITALDTISYAIECGRYKNVVIISSEISSVGLNWGQNESSILF 160
227813961  81 SGTIQQAIPSTASLIQEQLGLQHSGIPCFDINSTCLSFITALDTISYAIECGRYKNVVIISSEISSVGLNWGQNESSILF 160
229604721  81 SGTIQQAIPSTASLIQEQLGLQHSGIPCFDINSTCLSFITALDTISYAIECGRYKNVVIISSEISSVGLNWGQNESSILF 160
218904365  81 SGTIQQAIPSTASLIQEQLGLQHSGIPCFDINSTCLSFITALDTISYAIECGRYKNVVIISSEISSVGLNWGQNESSILF 160
296107209  73 CGAGEQPIPCTAVLVQKQLGLDNSGIACFDINSTCLSFLTALDAASYMLSGGRFNRILIVSSDIPSFGLDWSDLETCTIF 152
52841859   81 CGAGEQPIPCTAVLVQKQLGLDNSGIACFDINSTCLSFLTALDAASYMLSGGRFNRILIVSSDIPSFGLDWSDLETCTIF 160
226314262 161 GDGAAAVVIGRtpETESSRILGSSMKTYSEGAHYSEIRGGGTLIHPRQFAQGREAdfAFDMDGRKIFRLTSQLITGFVDR 240
54297551  161 GDGAAACVVER--SNDSSRILSAHMKTYSLGAAFCEVQAGGTLMPPASEYDKKYG--LFKMDGKRVFKLASQMIEPMQEE 236
148359166 153 GDGAAACVVER--SNDSSRILSAHMKTYSLGAAFCEVQAGGTFMPPASKYDKKYG--LFKMDGKRVFKLASQMIGPMQEE 228
49186023  161 GDGAAAVVITK--GDHSSSIIASHMETYSSGAHLSEIRGGGTMIHPREYSEERKEdfLFDMNGRAIFKLSSKYLMKFIDK 238
47528539  161 GDGAAAVVITK--GDHSSSIIASHMETYSSGAHLSEIRGGGTMIHPREYSEERKEdfLFDMNGRAIFKLSSKYLMKFIDK 238
227813961 161 GDGAAAVVITK--GDHSSSIIASHMETYSSGAHLSEIRGGGTMIHPREYSEERKEdfLFDMNGRAIFKLSSKYLMKFIDK 238
229604721 161 GDGAAAVVITK--GDHSSSIIASHMETYSSGAHLSEIRGGGTMIHPREYSEERKEdfLFDMNGRAIFKLSSKYLMKFIDK 238
218904365 161 GDGAAAVVITK--GDHSSSIIASHMETYSSGAHLSEIRGGGTMIHPREYSEERKEdfLFDMNGRAIFKLSSKYLMKFIDK 238
296107209 153 GDGAAACVVER--SNDSSRILSAHMKTYSLGAAFCEVQAGGTFMPPASKYDKKYG--LFKMDGKRVFKLASQMIGPMQEE 228
52841859  161 GDGAAACVVER--SNDYSRILAAHMKTYSFGADFCQVQAGGTFMPPASEYDKKYG--LFKMDGKRVFKLASQMIGPMQEE 236
226314262 241 LLSSASVTKEQIRTVIPHQASGMAMRIMAGKLGFSDQQMVNILADHGNVIAASIPMALHEAIGQNRVQRGDHLMLLGTSA 320
54297551  237 LFAKASITLNDVDWVVPHQASLLAMHHIRKKLGIPGEKFVDIYTTHGNQMAASLPSALCHLIHNHNLERGQLVYLLGTGA 316
148359166 229 LFAKASITLNDVDWVVPHQASLLAMHHIRKKLGIPGEKFVDIYTTHGNQMAASLPSALCHLIHNHNLERGQLVYLLGTGA 308
49186023  239 LLMDTGYSLADIDLIVPHQASGPAMRLIRKKLGVDEERFMTIFEDYGNMISASIPVALFEAIKQKKVQRGNKILLLGTSA 318
47528539  239 LLMDTGYSLADIDLIVPHQASGPAMRLIRKKLGVDEERFMTIFEDYGNMISASIPVALFEAIKQKKVQRGNKILLLGTSA 318
227813961 239 LLMDTGYSLADIDLIVPHQASGPAMRLIRKKLGVDEERFMTIFEDYGNMISASIPVALFEAIKQKKVQRGNKILLLGTSA 318
229604721 239 LLMDTGYSLADIDLIVPHQASGPAMRLIRKKLGVDEERFMTIFEDYGNMISASIPVALFEAIKQKKVQRGNKILLLGTSA 318
218904365 239 LLMDTGYSLADIDLIVPHQASGPAMRLIRKKLGVDEERFMTIFEDYGNMISASIPVALFEAIKQKKVQRGNKILLLGTSA 318
296107209 229 LFAKASITLNDVDWVVPHQASLLAMHHIRKKLGIPGEKFVDIYTTHGNQMAASLPSALCHLIHNHNLERGQLVYLLGTGA 308
52841859  237 LFAKASITLNDVDWVVPHQASLLAMHHIRKKLGIPGEKFVDIYTTHGNQMAASLPSALCHLIHNHNLERGQLVYLLGTGA 316
226314262 321 GLSLGGIVLEY 331
54297551  317 GLSAAGMILEY 327
148359166 309 GLSAAGMILEY 319
49186023  319 GLSIGGILLEY 329
47528539  319 GLSIGGILLEY 329
227813961 319 GLSIGGILLEY 329
229604721 319 GLSIGGILLEY 329
218904365 319 GLSIGGILLEY 329
296107209 309 GLSAAGMILEY 319
52841859  317 GLSAAGMILEY 327
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap