Conserved Protein Domain Family
PRK07203

?
PRK07203: PRK07203 
putative chlorohydrolase/aminohydrolase; Validated
Statistics
?
PSSM-Id: 235963
View PSSM: PRK07203
Aligned: 66 rows
Threshold Bit Score: 662.016
Threshold Setting Gi: 167630693
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 160903172   1 MLLIGNATVLTFDEETpIINNGAVLIEGIKIKEIGetEVLLQKYPNAVFKNARNKVLMPGLINTHTHLYSTFARGMnSKT 80
gi 257784042   1 MLLIVNGRVITRDEAHpYIEDGAVAIEGQKIVAVDtrAKLEAAYPDAEKLDAHGGVIMPGLINCHTHIYSGLARGL-AIK 79
gi 153937272   1 MLLIGNGKVITRDNTRpIIDNGCIAVDENKIIEIGstETLKNKYKESQFIDAKGKLIMPGFINTHMHYYSTFARGM-AND 79
gi 170761329   1 MLLIGNGKVITRDNTRpIIDNGCVAVDENKIVEIGstETLKSKYKESQFIDAEGKLIMPGFINTHMHYYSTFARGM-AND 79
gi 226950314   1 MLLIGNGKVITRDNTRqIIENGCIAVDENKIIEIGstEALKNKYKKSQFIDAKGKLIMPGFINTHMHYYSTFARGM-AND 79
gi 237796338   1 MLLIGNGKVITRDNTRpIIDNGCVAVDENKIIEIGstETLKSKYKEFQFIDAEGKFIMPGFINTHMHYYSTFARGM-AND 79
gi 153941389   1 MLLIGNGKVITRDNTRpIIDNGCIAVDENKIIEIGstETLKNKYKESQFIDAKGKLIMPGFINTHMHYYSTFARGM-AND 79
gi 170756948   1 MLLIGNGKVITRDNTRpIIDNGCIAVDENKIIEIGstETLKNKYKESQFIDAKGKLIMPGFINTHMHYYSTFARGM-AND 79
gi 269120284   1 MILIGNGRVFTRDENNpYIENGAVLIDGKVIKEIGktDELKAKYPDAQYKDAKGHLVMPGFINPHMHYYSTFARGM-FLD 79
gi 83590789    1 MLLIGNGRLLSLVPGKpYQEDGAVAIDGDLIVAVGptAELKARYPAAEWLDARGMVIMPGMINTHMHLYSTFARGM-ALK 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 160903172  81 DIPPQNFIEILEKLWWRLDNTLNEDDIYYSALFAILECIKNGVTTIFDHHASFNYIDGSLDIIAQAAMEAGIRANLCYEV 160
gi 257784042  80 DCNPHNFLENLEQQWWNIDRHLTLDGTRACAYATILDSLRDGVTTIFDHHASFCEIPDSLFAIKDVAKELGIRACLCYET 159
gi 153937272  80 SPPAKSLCDILTGLWWRLDKVLTLEDVYYSAAVPMIDQIKNGVTTVFDHHASTHAVKGSLFKIAEAAETMGIRSNLCYET 159
gi 170761329  80 SPPAKSLCDILTGLWWRLDKVLTLEDVYYSAAVPMIDQIKNGVTTVFDHHASAHAVKGSLFKIAEAAKAMGIRSNLCYET 159
gi 226950314  80 SPPAKSLCDILTGLWWRLDKVLTLEDVYYSAAVPMIDQIKNGVTTVFDHHASAHAVKGSLFKIAEAAEAMGIRSNLCYET 159
gi 237796338  80 SPPAKSLCDILTGLWWRLDKVLTLEDVYYSAAVPMIDQIKNGVTTVFDHHASAHAVKGSLFKIAEAAKAMGIRSNLCYET 159
gi 153941389  80 SPPAKSLCDILTGLWWRLDKVLTLEDVYYSAAVPMIDQIKNGVTTVFDHHASAHAVKGSLFKIAEAAETMGIRSNLCYET 159
gi 170756948  80 SPPAKSLCDILTGLWWRLDKVLTLEDVYYSAAVPMIDQIKNGVTTVFDHHASAHAVKGSLFKIAEAAETMGIRSNLCYET 159
gi 269120284  80 NPPATMFSDILKGLWWRLDRALTLEDVYYSAAMPMIEQIKSGVTTVIDHHASAYAVEGSLFKIADAAREFGIRSNLCYET 159
gi 83590789   80 DPPPTNFLEILQRLWWRLDKALTLEDVYYSALLPLIDCIKSGTTTILDHHASPYAVTGSLEMIARAAMETGVRTCLAYEV 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 160903172 161 SDRHGQTKSDASLKENERFIRKIQVSQNDKLGGMIGLHASFTLEDRTLNKASELADELHVPFHIHVAEGREDLQDSVKRG 240
gi 257784042 160 SDRDGEAKRDESIAENAAFAKWAADEDDDMIAAMFGGHALFTLSDETLDKMVEANNGL-TGFHIHVCEGMDDVYDSALNH 238
gi 153937272 160 SDRDGEKIAQEGINENVEFIKHCNAKNDDMIKGMFGLHASMTISDKTLEKCVDAVKGLNTGFHVHCGEGIEDLEDSKKKY 239
gi 170761329 160 SDRDGEKIAQEGINENVEFIKHCNAKNDDMIKGMFGLHASMTISKKTLGKCVDAAKSLNTGFHVHCGEGIEDLEDSKKKY 239
gi 226950314 160 SDRDGEKIAQEGINENVEFIKHCNAKNDDMIKGMFGLHASMTISDKTLEKCVDAVKGLNTGFHVHCGEGIEDLEDSKKKY 239
gi 237796338 160 SDRDGEKIAQEGINENVEFIKHCNAKNDDMIKGMFGLHASMTISEKTLEKCVDAAKGLNTGFHVHCGEGIEDLEDSKKKY 239
gi 153941389 160 SDRDGEKIAQEGINENVEFIKHCNAKNDDMIKGMFGLHASMTISDKTLEKCVDAVKGLNTGFHVHCGEGIEDLEDSKKKY 239
gi 170756948 160 SDRDGEKIAQEGINENVEFIKHCNAKNDDMIKGMFGLHASMTISDKTLEKCVDAVKGLNTGFHVHCGEGIEDLEDSKKKY 239
gi 269120284 160 SDRDGEAIAKAGIKENADFIKYCNEQKDDMIKGLFGFHASMTVSDKTLDESLAAAANVNGGFHVHCAEGIEDVADSLAKY 239
gi 83590789  160 SDRDGKEIMRQGIAENIAAIKKYRGKEG-LISATFGLHASLTLSDATLEACREAEGEVGSGFHIHVAEGIQDVEDALAKS 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 160903172 241 YMGVVDRLTKFKILRPHTLAAHGVHIKKEEIPMLKKSGAWVVHNPESNMGNAVGAAPIKDFFDHeilTGLGTDAYTHDMF 320
gi 257784042 239 GTTAVHRLLDHGLLGEKTMLGHCIHVTPADMDILAHTHTSIVNNPESNMGNAVGCAPVLEFFKRgidVCMGTDAYTHDML 318
gi 153937272 240 GKGIIERWNNAGVLCDKTIAVHCIYVSDEEMDMLKEKNTIVVHNPESNMGNAVGVSPVLKMYKKgilLGLGTDGYTPDII 319
gi 170761329 240 GKGIIERWYDAGALSDKTIAVHCIYVSDEEMEMLKEKNTIVVHNPESNMGNAVGVSPVLKMYKKgilLGLGTDGYTPDII 319
gi 226950314 240 GKGIIERWNDAGVLCDKTIAVHCIYVSDEEMDMLKEKNTIVVHNPESNMGNAVGVSPVLKMYKKgilLGLGTDGYTSDII 319
gi 237796338 240 GKGIIERWYDAGALCDKTIAVHCIYVSDEEMEMLKEKNTIVVHNPESNMGNAVGVSPVLKMYKKgilLGLGTDGYTPDII 319
gi 153941389 240 GKGIIERWNDAGVLCDKTIAVHCIYVSDEEMDMLKEKNTIVVHNPESNMGNAVGVSPVLKMYKKgilLGLGTDGYTPDII 319
gi 170756948 240 GKGIIERWNDAGVLCDKTIAVHCIYVSDEEMDMLKEKNTIVVHNPESNMGNAVGVSPVLKMYKKgilLGLGTDGYTPDII 319
gi 269120284 240 NQRVIERWYKRGVLNEKSIAVHCIHLSSDEIDMLKESNVAVVHNPESNMGNAVGIAPILEMMKRgvlVGLGTDGYTADMT 319
gi 83590789  239 GKRVVERLAVNGILGPNTIAAHCVHVTDREIAILKETGTLVVHNPESNMGNAVGCAPVGDMLAAgvpVGLGTDGYTSDMF 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 160903172 321 ESIKVANLLQKHQLGDPqagWNEVYNMAFNNNMQIVSNLL-----GVEIGKIKENFRADLIIVDYIPPTPIEKDNVYSHI 395
gi 257784042 319 ESLKVFLPMQRHNACMPnvgWVEAMTMLFKNNVKMAEKYFstksnGKPLGKLAPGAAADIAIFDYKPFTPFSDENIDGHM 398
gi 153937272 320 ESYKVANIIHKHATSDStvaWTEIPEMLFENNGKITERFI-----DGKIGVLKEGALADIIVVDYNPPTPINENNINSHI 394
gi 170761329 320 ESYKVGNIIHKHATSDStvaWTEIPEMLFENNRKITERFI-----DGKVGILKEGALADIIVVDYNPPTPINENNINSHI 394
gi 226950314 320 ESYKVANIIHKHATSDStvaWTEIPEMLFENNGKITERFI-----DGKVGVLKEGALADIIVVDYNPPTPINENNINSHI 394
gi 237796338 320 ESYKVANIIHKHATSDStvaWTEIPEMLFENNRKITERFI-----DGKVGILKEGALADIIVVDYNPPTPINENNINSHI 394
gi 153941389 320 ESYKVANIIHKHATSDStvaWTEIPEMLFENNGKITERFI-----DGKVGVLKEGALADIIVVDYNPPTPINENNINSHI 394
gi 170756948 320 ESYKVANIIHKHATSDStvaWTEIPEMLFENNGKITERFI-----DGKVGVLKEGALADIIVVDYNPPTPINENNINSHI 394
gi 269120284 320 ESYKVANIIHKHVNKLPsvgWTEPPQMLFDNNRKIVNRFI-----DGTTGILKEGAYADIIIVDYKGPTPVNETNLNSHI 394
gi 83590789  319 ESLKTANVLRKFVSGDPgagWAEVPAMAFENNRRIASRFF-----PHPLGRLEPGAYADVILVDYQAPTPLGRDNWFGHL 393
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*...
gi 160903172 396 LFGMNGGMVETVIIDGKIIMDDREVtILDYERIHRRTREQARRFWERF 443
gi 257784042 399 LFGFEGKNCRTTIVNGKVLYKDREFvAFDEDKINAWTMVEAKKLWGEL 446
gi 153937272 395 LFGINGRHVDTTIINGKVLMEDRKLlHVDEERVMARSRELAKEVWKRF 442
gi 170761329 395 LFGINGRHVDTTIINGKVLMQDRKLlHVDEERVMARSRELAKEVWKRF 442
gi 226950314 395 LFGINGRHVDTTIINGKVLMEDRKLlHVDEERVMARSRELAKEVWKRF 442
gi 237796338 395 LFGINGRHVDTTIINGKVLMEDRKLlHVDEERVMARSRELAKEVWKRF 442
gi 153941389 395 LFGINGRHVDTTIINGKVLMEDRKLlHVDEERVMARSRELAKEVWKRF 442
gi 170756948 395 LFGINGRHVDTTIINGKVLMEDRKLlHVDEERVMARSRELAKEVWKRF 442
gi 269120284 395 LFGVTGRNVDTTIINGRVVMDERKLvDIDEDRVAAKSVELAQKLWNRI 442
gi 83590789  394 LFGFNGGLVDTTVVGGKVLMQRQRLlHLDEAAIAARARELAIKVWERF 441
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap