Conserved Protein Domain Family
fliF

?
PRK07193: fliF 
flagellar MS-ring protein; Reviewed
Statistics
?
PSSM-Id: 235957
View PSSM: PRK07193
Aligned: 38 rows
Threshold Bit Score: 699.814
Threshold Setting Gi: 34498454
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145297444   9 PQGASDSFRTRVQEGLRNWRslsRDNKSILTIALLAAIVAGTIVVILWTSSKNYVPLYGKQELYDTANIMEMLEKEQVPF 88
gi 126176167  14 GTESSSGFIAGMTQKWHRFN---RGDRQVIALALLAVVVASVIVLMLWTATAGYRPLYGSQENVDTSQVLNVLDAEGIDY 90
gi 157959913  13 TNAGVNNPLNSLKEKWQQYN---RGDRQVVILAVLAIVAACVIVLMLWSASQGYRPLYGNQEGVETSQIIEVLEAEGISY 89
gi 91795006   14 GEIQSPSLFSSAAQGWRRFT---QGDKQVMVLALLATVVASVIVIMLWTASQGYRPLYGSQENVETSQVIEVLEAEGIYY 90
gi 157373218  14 DVRDKSEIVSSLKTKWQQFN---RGDRQVLVLAILASVVACVIVLLLWTASQGYRPLYGQQEKVETSQIIEVLEAEGINY 90
gi 167626144  14 DVNGNNDRLNSLKQKWHQFS---RGDRHAATLAILAIVAACVIVLMLWSTGQGYSPLYGNQENVETSHIIEVLEAEGISY 90
gi 212637769  14 NTATTNAGLNTLKEKWRDFN---RGDRQAAVLAIFAIVAACVIVLMLWSASQGYRPLYGNQENVDTAQIIEVLESEGISY 90
gi 262396483  11 TANSMDDVTTKLKQIWSSSQ------RNLVLSAVLAAIVAAIIVVALWSSSQSFRPLYSQQERFDIGEIVSVLESEGVSY 84
gi 156976202  24 SNRGMDDVTNKIKQLWSSSQ------RNLVLSAVLAAIVAAIIVVALWSSSQSFRPLYSQQERFDIGEIVSVLESEGISY 97
gi 28901391   24 PAGNMDDVTNKLKQLWSSSQ------RNLVLSAVLAAIVAAIIVVALWSSSQSFRPLYSQQERFDIGEIVSVLESEGVSY 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145297444  89 RLEKSSGQILVPESQLAHVRMALAARGVRAAMPSGLEGLDtVTGLGTSEFMEGARYRHALEGELARTIISLDAVRSARVH 168
gi 126176167  91 RLDANSGAVLVAEEQVGNARMILAAKGVKAKVPSGMEALD-NTALGTSQFMEQAKYRNSLEGELARTIMSLKLVRAARVH 169
gi 157959913  90 RIDANSGLILVTEDKLGPARMLLAARGVKAKVPSGMESLE-NSNIGTSQFMEQAKYRYSLEGELSRTIMALKAVKTARVH 168
gi 91795006   91 RIESHTGLVLVADDQLGKARMLLAARGVKAKVPSGMDELD-SSSLGTSQFMEQAKYRHGLEGELARSIMSLKNVRSARVH 169
gi 157373218  91 RLEANSGLVLVQEDKLGKARMLLAARGVKAKVPSGMESLD-NSGIGTSQFMEQAKYRHSLEGELSRTIMALKAVRTARVH 169
gi 167626144  91 RLDPTSGLILVPEDRVGNARMVLAARGVKAKVPSGMESLD-SSAIGTSQFMEQAKYRYSLEGELSRTIMALKSVKTARVH 169
gi 212637769  91 RLDASSGLVLVVEDKLGRARMLLAARGVKAKVPSGMDSLD-SSGIGTSQFMEQAKYRYSLEGELSRTIMALKAVRSARVH 169
gi 262396483  85 RMQEQNGQVLVPEGEVAKVRMLLASKGVKAKLPTGLDSLKeDSSLGTSQFMETARYRHGLEGELVRTIMSLNSVANARVH 164
gi 156976202  98 RMQEQNGQVLVPEGEVARIRMLLASKGVKAKLPTGLDSLKeDSSLGTSQFMETARYRHGLEGELVRTIMSLNAVANARVH 177
gi 28901391   98 RMQEQNGQVLVPEGEVARIRMLLASKGVKAKLPTGLDSLKeDSSLGTSQFMETARYRHGLEGELVRTIMSLNSVANARVH 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145297444 169 LAIPKRTLFVGRDEEKPSASVMMDLQPGQAMEPGQVEAIANLVAGSISGMKPGAVTIVDQAGQLLSAELGDKAGFGKQSV 248
gi 126176167 170 LAIPKQTLFIRQEPELPTASVMLQLDPNTRLSESQVEAIVNLVAGSVTGLTASNIKVVDQDGRYLSENISGNQDLSQSRN 249
gi 157959913 169 LAIPKKTLFIRQQPELPTASVMLELYAGSNIQPEQIESIVNLVAGSVTGMTPDRVQVVDQEGNHLSSSISVNKDITQARD 248
gi 91795006  170 LAIPKRSLFIRQTPELPTASVMLQLSPGAELSQSQVEAVVNLVAGSVTGMETSGVKIVDQEGRFLSANINEDQDMTQARD 249
gi 157373218 170 LAIPKRTLFIRQQPELPSASVMLDLYAGSKIQPGQIEAIANLVAGSVTGMTPERVQIVDQEGNHLSSGIAINQDITQARD 249
gi 167626144 170 LAIPKKTLFIRQQPELPSASVMLDLYAGQHLQPEQITSIANLVAGSVTGMTPERVQIVDQEGNHLSSEINANQDLTQARD 249
gi 212637769 170 LAIPKKTLFIRQQPELPSASVMLDLYSGSNIQPENIESIVNLVAGSVTGMTPERVQVVDQNGNHLSSAISANKDITQARD 249
gi 262396483 165 LAIPRQTLFVRQNSENPSASVMLELKPGEDLKSEQVEAIINLVVGSVTAMKPEFVSVIDQYGRLLSADV-ASAEAGKVNA 243
gi 156976202 178 LAIPRQTLFVRQNTENPSASVMLELKPGEDLKPEQVEAIINLVVGSVTAMKPEFVSVIDQYGRLLSADV-ASAEAGKVNA 256
gi 28901391  178 LAIPRQTLFVRQNGENPSASVMLELKPGEDLKPEQVEAIINLIVGSVTAMKPEFVSVIDQYGRLLSADV-ASAEAGKVNA 256
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145297444 249 QQMEYVRKLEQYIRQRASDMLYPMLGTSNFRVQIAADVNFNAVEETQQQLDPQGVVTKESTKSDKTIDALALGIPGALSN 328
gi 126176167 250 KQLQYTRELENSLVANASSMLEPVLGQENFQVRVTAKVNFNQVEETKESLDPQNVVTQERTSVDDSSNSIAAGIPGALSN 329
gi 157959913 249 RQLKYTQELEQSLIDRASSMLLPILGRDHFEVQVAANVNFNQVEETKESLDPLAVVTKENLTSNETNSDMALGIPGALSN 328
gi 91795006  250 RQITYTRELEQNLMHNASSMLEAILGPNNFQVKIAAKVNFNQIEETKEALDPQSVLVQERTSSDDKNAALAQGIPGALSN 329
gi 157373218 250 RQLKYTQELEQSLINRASSMLAPVLGKENFQVQIAAQVNFNQVEETRESLDPQSVVTQEKQSINDTNSDIAMGIPGALTN 329
gi 167626144 250 KQLQYTQELEQSLINRASSMLQPILGQDNFQVQVAALVNFNQVEETRESLDPQTVVSQEKQSTNQTSGDMALGIPGALSN 329
gi 212637769 250 RQLKYTQELEQSLIGRASSMLQPILGQDNFQVQVSAKVNFNQVEETKESLDPVSVVTQENQSSNETNADMALGIPGALSN 329
gi 262396483 244 KYLEYQKNVEKQIIQRAADMLTPIVGPSNFRVQVAADMDFSQVEETQEILDNAPVVRNEHTIHNNSVDQIALGVPGSLSN 323
gi 156976202 257 KYLEYQKSVEKQIIQRAADMLTPIVGPSNFRVQVAADMNFSQVEETQEILDNAPVVRNEHTIQNNSVDQIALGIPGSLSN 336
gi 28901391  257 KYLEYQKNVEKQIIQRAADMLTPIVGPSNFRVQVAADMDFSQVEETREILDNAPVVRNEHTIQNNSIDQIALGVPGSLSN 336
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145297444 329 RPP---ETTPKNEQPaqnqveantdtqknDSRTERQEVSKQYENSRTIVHTRYQQGRLEKMNVSILLNQQSAPK-DGWSA 404
gi 126176167 330 KPP---QAGKAAADD--------------KTRNLKQEESRQYDVGRSVRHVRYQQMQLENLSVSVLINSATSQG-AFNDE 391
gi 157959913 329 QPP---AAEADESNA---------------RRNLNSQESRQFDTGRSVRHTRYQQMQLENLSVSVLINKQSAGE-TGWTQ 389
gi 91795006  330 QPP---QAAEGDKKD--------------NTRNLRQEANRQFDVGRSVRHIRYQQMQLENISVSVLVNNTVATG-LTTDD 391
gi 157373218 330 QAP---KAQANKTEEn-------------TRRNLNQQESRQYEVGRSVRHTRFQQMQLENLSVSVLLNNQAAGE-NGWNE 392
gi 167626144 330 QPP---TADAATNNS---------------TSNLNQQESRQFEVGRSVKHTRYQQMQLENLSISVLLNNQAAGE-TGWTQ 390
gi 212637769 330 QPP---AATPEENNN---------------RRNINQKESRQFDVGRSVRHTRFQQMQLENLSVSVLLNSQAAGE-TGWSQ 390
gi 262396483 324 QPPvtgEEVETNDSQ---------------NTNARSEVNRQYAVGSSVRRTQYQQGQIEKMSVSVLLNSKASPDgVAWSE 388
gi 156976202 337 QPPvtgETPTNDSQN----------------TNARSEVNRQYAVGSSVRRTQYQQGQVEKLSVSVLLNSQAAPDgVAWSE 400
gi 28901391  337 QPP---VTGEAATNDs-------------QNTNARSEVNRQYAVGSSVRRTQYQQGQIEKLSVSVLLNSKASPDgVAWSD 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145297444 405 EQLEQIRQMVERSVGFDNARGDQISLQVFDFTA-AVPIVPPESgWWETPYWQDSLRYLVGGLLGLTLVFFGIRPLVKHLV 483
gi 126176167 392 AQLAKFGNMVKDAIGFSAARGDSFTINAFEFTPtVTAEFTPSP-WWQSENYQAYLRYIIGGILGFGLILFVLRPLVKHLT 470
gi 157959913 390 TQLDQLSSMVQDAIGFSAARGDQFSINSFDFAPtQIAEFEPMP-WWQGESYQTYLRYFIGALLGLAMIFFVLRPLVKHLT 468
gi 91795006  392 AELTKLGSMVKDAIGFSSERGDSFSINAFAFSVpTVAEFEPLP-WWQVEDYQAYLRYLIGGLLGLGLILFVLRPLVSHLT 470
gi 157373218 393 AQVSQLGTMVKDSIGYSMQRGDQFSINSFDFAPvQIAQFEPMP-WWQTEGYQAYLRYFIGGILGFGLIFFVLRPLVSHLT 471
gi 167626144 391 PQLDQMSTMVQDAIGYSAARGDQFSISSFNFAPvKIAEFEPLP-WWQGESYQAYLRYFIGAILGLGMIFFVLRPLVQHLT 469
gi 212637769 391 PQLQQLSSMVQDAIGFSQARGDQFSINSFEFAPiTVAQFEPMP-WWQGESYQAYLRYFIGAVLGLGMIIFVLRPLVAHLT 469
gi 262396483 389 ADKEQISNMIMDAVGISAARGDSLSLMSFNFTPiEIDAPPALP-WWQDPTVQQPIRYVIGGLLGLAMIFFVLRPLIMHLT 467
gi 156976202 401 ADKSQISTMIMDAVGISNARGDSLSLMSFNFTPiEIDAPPALP-WWQDPTVQQPLRYVIGGVLGLAMIFFVLRPLIMHLT 479
gi 28901391  401 ADKAQISTMITDAVGISAARGDSLSLMSFNFTPiDIDAPTALP-WWQDPTVQQPLRYVIGGMLGLAMIFFVLRPLIMHLT 479
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145297444 484 RTQ-----QLPDEEPTE-EQDEPQEPTVGLSmrrdDDAALTAPMMSNgliradnqmEPQFSSLNLEALPEPGSELEVQLQ 557
gi 126176167 471 RTA-----QMTAPRIEP-VALSAAPAGALDG----PVADAASNQPHQ---------LPSAEWLGSQGLPEPGSPLTVKME 531
gi 157959913 469 KTVehnlkSIDEPAQPS-LPPAQATVTKLEGgnnaQAIADQLIGQNQk--------TGDLNWSGDASLPEPSSPLAVKME 539
gi 91795006  471 FTAkhvdnETREPETIN-LAKSAESTTAESNtttrAAISQGHSAEKS-----------TAEWLGGLNLPEPGSPLTVQME 538
gi 157373218 472 RTAehslkEELPQVEPAlEAPSSSSISGVQSgdgqALADQLMGLEQD---------KSDTDWLSNQGLPAPGSPLTVKME 542
gi 167626144 470 RTVeh-niKDTLPSTQPlMPPAEAATAHLSQdaaqEAADNLVALNNA---------NINSNWTSNLNLPAPGSPLTVQME 539
gi 212637769 470 RTVey-nlKDDGSNIEP-KRIPPADVSPTDLtlnnDNKDDPQAMADKlmgl--dknPSNGEWSSDIGLPAAGSPLAVKME 545
gi 262396483 468 GVD-----KPVPELDFA-EPQEEPDYDNLQTreerEHEEVLDRRLSEkg-----isASSGLDVNSDMLPPAGSPLEIQLK 536
gi 156976202 480 GAD-----KPAQELEFA-EPQEEPQYDNLQTreerEREEVLNRKLSEkg-----iaVSSGLDVNSDMLPPAGSPLEIQLK 548
gi 28901391  480 GAD-----KPVPELNFAePPQEEPDYDNLQTreerEHEEVLNRRLSEkg-----isASTGLDVNSDMLPPAGSPLEIQLK 549
                        570       580
                 ....*....|....*....|....*..
gi 145297444 558 HLQLLVEKDTARVAEVVRSWVSGNEQR 584
gi 126176167 532 HLALLANKEPARVAEVIAHWIGDKDGE 558
gi 157959913 540 HLSLLANQEPARVAEVIAHWIGDTEHD 566
gi 91795006  539 HLGMLANQEPARVAEVLAHWIGDKDAD 565
gi 157373218 543 HLSLLANQEPARVAEVIAHWIGDNENE 569
gi 167626144 540 HLSLLANQEPARVAEVISHWISDRDSE 566
gi 212637769 546 HLSLLANQEPARVAEVIGHWISEKDEQ 572
gi 262396483 537 HLQLIANEEPERVAEILKQWVNINEHS 563
gi 156976202 549 HLQLIANEEPERVAEILKQWVNINEHS 575
gi 28901391  550 HLQLIANEEPERVAEILKQWVNINEHS 576
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap