Conserved Protein Domain Family
dnaE

?
PRK07135: dnaE 
DNA polymerase III DnaE; Validated
Statistics
?
PSSM-Id: 235944
View PSSM: PRK07135
Aligned: 11 rows
Threshold Bit Score: 1221.46
Threshold Setting Gi: 71894540
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71893932    1 MQLINLHTRTEYTFLSSTIKLDSLIKFALENNLKTLVITDlNSMFGVPKFYKLCKQNKINPVIGLEIEIEN-FNFILLAK 79
gi 15829190    2 REFINLHTNSEYSFLDSLIRINDLVQYAKENNLKTLVLTD-TNFHGADKFYFLCKKNNIKAVLGLDIEVDH-KRVILLAK 79
gi 47459322    2 EKLINLHTNSEYSILESAISLEHLISYAKHNQLKYLSLTDhNTMFGVPEFYELCKKNSIKPIIGLDLDVEN-YRLVLIAK 80
gi 72080910    9 MQLINLHTRTEYTFLSSTIKLDSLIKFALENNLKTLVITDlNSMFGVPKFYKLCKQNKINPVIGLEIEIEN-FNFILLAK 87
gi 54020612    1 MQLINLHTRTEYTFLSSTIKLDSLIKFALENNLKTLVITDlNSMFGVPKFYKLCKQNKINPVIGLEIEIEN-FNFILLAK 79
gi 71894540    4 KKPIYLHLKTEFSFLNSAIRLNKLFNLIESQKIEYLAITDkENLYALPYLLEFREKYKFKLIIGCEFELDNkLEVIILAK 83
gi 148377433   2 NEFIDLYNTTEYSFLESLIKVKDLVRLSKENGKRAVVLSDhNNMFALGEFLKQCAAYEIKPIIGVDLDVEE-SRFILLAK 80
gi 240047654   1 MQLINLHTNSEYSFLSSTIKIDSLINYAIQNNLSTLVLTDiNNLFAVPKFYHLCKKNNINPIIGLQLEAEN-YHFILLAK 79
gi 291320098   2 NEFIDLYNTTEYSFLESLIKVKDLVRLSKENGKRAVVLSDhNNMFALGEFLKQCAAYEIKPIIGVDLDVEE-SRFILLAK 80
gi 304373272   2 QKLINLHTNTEYSFLQSTIKISSLIEYARQHQLKHLVITDrDNMFGVAKFYNECKANNINPIIGLDLEIKS-FRFILIAK 80
gi 294155789   1 MKHYYLHTNTEFSFLNSTIKLEKLFKLASEKEYEYLAMTDiNNMFALGMFLNLSKKYNIKPIIGFELLQDN-ISVIIIAK 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71893932   80 NYSGYVILSEFSSKKTKKKDLFLTDLAEk-DDIIIVDHPKKGFYAQKKEQLgklfgenQLKNYYIVEN--NPKIENAVYL 156
gi 15829190   80 NTSGFRSLMLFSESNRNGLEISLNQLEKtqDDLIIINHPRLGFSMDEIAQS-------SIKNFYNTSN--NDQDPLSLYV 150
gi 47459322   81 NYQGYLELIKLSSKKMLNENVELNHIDS--TNLFIIDHPTKGSFSKFGQSI-------EIKNYYINSL--DPKHKNAIFT 149
gi 72080910   88 NYSGYVILSEFSSKKTKKKDLFLTDLAEk-DDIIIVDHPKKGFYAQKKEQLsklfgekQLKNYYIVEN--NPKIENAVYL 164
gi 54020612   80 NYSGYVILSEFSSKKTKKKDLFLTDLAEk-DDIIIVDHPKKGFYAQKKEQLsklfaekQLKNYYIVEN--NPKIENAVYL 156
gi 71894540   84 NLAGYKLINELIYQKSNNNSINLSDLNS--ENIFVIDSDTNGYLKNKKSLEv------ELPNFFYNSKfqLENKDNVVYA 155
gi 148377433  81 NYEGFKLINSLILKKSR-EEIKLSDIIS--DNLFIIDHPSNGLYAKNEHHKl-----sDNKNYYISSP--DSSIPNSIYV 150
gi 240047654  80 NYLGYQHLSALSSKKMHNQEISILELSN--ENVIIIDHPELGFYTKNKQQL-------KLDNYYVVSN--DVNLENAVFV 148
gi 291320098  81 NYEGFKLINSLILKKSR-EEIRLNDIIS--DNLFIIDHPSNGLYAKNEHHKl-----sDNKNYYISSP--DSSIPNSIYV 150
gi 304373272  81 NYQGFLHLSLLSSKKMSFKEIEIEELDN--ENIIVIDHPKLGLYSKTKKML-------EFSNYFVHSN--DSKIANSVYV 149
gi 294155789  80 NYEGYIELNNIAFLVSKGQKVELESLDS--NNVYVIDHEENGYLKNNLEVP-------KISNFWYNSK--TIISDQTIYA 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71893932  157 QERNLLFAEEKIYLEALSKI-KGTTLDSSTKFFDfNKWEQEIDPIIIKRTNYLVENIQIQFPKIDFN-LPDLDHKNGLES 234
gi 15829190  151 VENKLFNVKDNPILEMLNST-NNNQKNKGIEFKG-FSHYAPISELMQKRINDIVDQCNFEYKKPEIT-LPKFMNNLGISS 227
gi 47459322  150 KEIRILEKEDNEILKTFNQIaNNEEEEFTLPEYE---INEKLPQNVLNNIFYIIENSNVEFPKEYQNyLPQYD--LKIDS 224
gi 72080910  165 QERNLLFAEEKIYLEALSKI-KGTTLDSSTKFFDfNKWEQEIDPIIIKRTNYLVENIQIQFPKIDFN-LPDLDHKNGLES 242
gi 54020612  157 QERNLLFAEEKIYLEALSKI-KGTTLDSSTKFFDfNKWEQEIDPIIIKRTNYLVENIQIQFPKIDFN-LPDLDHKNGLES 234
gi 71894540  156 PVKKIIDKFENFTLNILDKIrEEFKENNNFDDFYsEEEFNDLDEKIYQNTLNLADQCFELEIDKEIK-LPEFSSNSKEE- 233
gi 148377433 151 KENKLIDVEDNETLNILLKLgNNKEANYNFSYFE----DYTTDSDFLARINFIVDNCNVTFPKKELK-LASFCESEEKNY 225
gi 240047654 149 QNRSVLYAKEEKYLKYLYKIkGADWVDK--KFYDfQEWSIDVDESIIKRTNELVSNIQIEFPKPFFN-LPDVPSFTSSNA 225
gi 291320098 151 KENKLIDVEDNETLNILLKLgNNKEANYNFSYFE----DYTTDSDFLARINFIVDNCNVTFPKKELK-LASFCESEEKNY 225
gi 304373272 150 QTRNVLYASEEKYLKILHKIaDSAEKDEAVDFIDfEMWYEQVDEQIIQRTNSLVENILIEFPEANMI-LPDFKNEANLNP 228
gi 294155789 149 PVKKVLFEDDNEALIALQTTgNNKITNSYYNDYFnEKDFIGIDNKVLLNVNTLVNSINIIFPDSTPK-LAEFKNDLTPE- 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71893932  235 DLLLKKILKEAVQNRRIELSNY--KWKARLQYEYETICKLKFTNYFLIIWDFLKWARKNEILIGPGRGSASGSLVAYLLE 312
gi 15829190  228 KDFLVKILKESWHEKSHKLQKYd-NAKQRIKYELSVISKLGFEDYFLIIWDIINWAKKNKIAIGPGRGSASGSLVSYLLN 306
gi 47459322  225 SIVLKEIVYKNFLEKIKKFEKYq-NVKERINYELNVINSLKFADYFLIIYDIVKFAKENKISVGPGRGSAAGSIVSYLLN 303
gi 72080910  243 DLLLKKILKEAVQNRRIELSNY--KWKARLQYEYETICKLKFTNYFLIIWDFLKWARKNEILIGPGRGSASGSLVAYLLE 320
gi 54020612  235 DLLLKKILKEAVQNRRIELSNY--KWKARLQYEYETICKLKFTNYFLIIWDFLKWARKNEILIGPGRGSASGSLVAYLLE 312
gi 71894540  234 ---IESKIKASERTKYLLLNYDkdLVIERINYELSIIKEQNFVDYFLIIADALSWARKNKISIGPGRGSVSGSLVAYVLE 310
gi 148377433 226 ELFIEKIKQGLAKHKKALLPYKt-AVNDRINYECSVIKKLVFINYFLIISDMIEYADNNGISIGPGRGSAAGSLISYLLG 304
gi 240047654 226 NDNLKSILEDSVIKKQDELKNYp-QVRKRLSSEYKVISELNFSNYFLLIWDFIKWARSQNILIGPGRGSSSGSLISYLLD 304
gi 291320098 226 ELFIEKIKQGLAKHKKALLPYKt-AVNDRINYECSVIKKLGFINYFLIISDMIEYADNNGISIGPGRGSAAGSLISYLLG 304
gi 304373272 229 DEFLQQLLEKQVAKKKAEFKNFp-NFKERLVYEFNIIKSLKFSNYFLIIWDFLRWARKNNILIGPGRGSSSGSLISYLLN 307
gi 294155789 227 KLLYKQCLIGLDINKKEFEKYSieTVMERLTYEYKTIVKLGFCSYFLIIKDVIDFAKNKGIYIGPGRGSAAGSLISFLLG 306
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71893932  313 ITSVNPLKYDLIFERFLNPQRITMPDIDIDIQDTRRQEVIDYLFEKYGPDHCATIITFSTLAAKSVFRDISKTF-GIPEI 391
gi 15829190  307 ITEVNPLEFNLFFERFLNEDRISMPDIDIDVQDNRRDELLNYIFEKYGEQNVSTISTFQFLGAKSSIRDVGRFL-GINIA 385
gi 47459322  304 ITSINPLKYDLLFERFLNPERITMPDIDIDFQDDRRDEIVEYVTKKYGHQKVALITTFQRFGAKMALRDVGRNL-NFTQV 382
gi 72080910  321 ITSVNPLKYGLIFERFLNPQRITMPDIDIDIQDTRRQEVIDYLFEKYGPDHCATIITFSTLAAKSVFRDISKIF-GIPEI 399
gi 54020612  313 ITSVNPLKYDLIFERFLNPQRITMPDIDIDIQDTRRQEVIDYLFEKYGPDHCATIITFSTLAAKSVFRDISKTF-GIPET 391
gi 71894540  311 ITDVNPLDFDLLFERFLNTKRVTYPDIDIDIQDDRRSEVLDYIFEKYGQKRCALITTFSTLGAKSAIKDVGRML-GISNS 389
gi 148377433 305 ITKINPLKYNLLFERFLNIDKVSWPDIDIDIQDDRRDEIFAYLQNKYGKSKVAVISTFQTMGTKQAIRDVGRML-DIPLS 383
gi 240047654 305 ITQINPLRYDLLFERFLNPLRQTMPDIDIDIQDTRRSEVIDYIQKTYGYEHTATIITFSTLAARSVFRDVSKAF-GISES 383
gi 291320098 305 ITKINPLKYNLLFERFLNIDKVSWPDIDIDIQDDRRDEIFAYLQNKYGKSRVAVISTFQTMGTKQAIRDVGRML-DIPLS 383
gi 304373272 308 ITQVNPLKFDLIFERFLNPKRISMPDIDIDIQDNRRDELIQYIQQKYGYENTALIITFSTFGAKMAFADVAKKLkNVSPT 387
gi 294155789 307 ITKINPLKYNLLFERFLNVDRVTMPDIDIDIQDDRRDEIAKYIVEKYGYEYCSYISTFQSIGAKMAIRDIGRYL-QINLN 385
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71893932  392 QINKNAKLIP---NNANLSQLYDQKSSEFRRLIEKGDnfkaennsEIYKKIYKISAFLEGMPRQSSTHAAGIVLSKIPIT 468
gi 15829190  386 KINEISKHID---AQQSLAEQYENNQSLRSYLQNQED--------PIFKKLIDFAMKIEGLPRQTGTHAAGIIISNEKIN 454
gi 47459322  383 DMNNISKLVK---LNQNLDEAYRTTKFKAQMLAS-----------PKHELLYKNARKIENFPRQVGTHAAGIIISNKNLI 448
gi 72080910  400 QINKNAKLIP---NNANLSQLYNQKSSEFRRLIEKGDnfkaennsEIYKKIYKISAFLEGMPRQSSTHAAGIVLSKIPIT 476
gi 54020612  392 QINKNAKLIP---NNANLSQLYDQKSSEFRRLIEKGDnfkaennsEIYKKIYKISAFLEGMPRQSSTHAAGIVLSKIPIT 468
gi 71894540  390 EVNLVTKTINdfdKNLTLESEYNKRNSKYKAIVSK------------YENLHEYATYIEGLYRQTGVHAAGIVIANNDIT 457
gi 148377433 384 DVNRISKSINafaNYSSIEEEFAKNLTFNKEVSSLKD----------YEKFINHVSKLQGLPRQYGIHAAGLIISDKDLN 453
gi 240047654 384 EVNANAKLIK---PNMTLQECYDEEKSAFRSLIDRQEqd----ktYKYKEIFKISKFLEGMPRQSGTHAAGIVVSKVPIC 456
gi 291320098 384 DVNRISKSINafaNYSSIEEEFAKNLTFNKEVSSLKD----------YEKFINHVSKLQGLPRQYGIHAAGLIISDKDLN 453
gi 304373272 388 DVLAITKHIP---FGLSLEQAYKTNANFRAYVEKQDNng-----nFLYKEIFEIAKFLEGMPRQSGTHAAGIVIADKPLY 459
gi 294155789 386 IIDSISKSLD---QNETLEEACLKNRVFKAEISE-------------YPKLLELAKKIEGIPRQHGIHPAGIIISNTKIT 449
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71893932  469 KLVPVHnSKENLNQIQYAAEFIEDFSLLKIDLLGLKNLTIVANILAKINSD---GHKITFn-------qLPISENSTNNL 538
gi 15829190  455 NYIPTF-IVNNKNQSQYSMENIEKMGFLKIDFLGLKTLSTITHIEERIAQFeqiDFDKIN---------SYIIDEKIKKV 524
gi 47459322  449 EIIPIMqSSVSNIQTQYSMNYLENFSLLKIDLLGLKALSTIKLIEQKIREAykiKYNFSNedeyteqlkKDLDPKKAFQL 528
gi 72080910  477 KLVPVHnSKENLNQIQYAAEFIEDFSLLKIDLLGLKNLTIVANILAKINSD---GHKITFn-------qLPISENSTNNL 546
gi 54020612  469 KLVPVHnSKENLNQIQYAAEFIEDFSLLKIDLLGLKNLTIVANILAKINSD---GHKITFn-------qLPISENSTNNL 538
gi 71894540  458 NYFPINkVLDKYNQVQLSLENLEKYGLIKIDFLGLKNLTIVKNIENLINPKlhfDNVINQn-------lNKFIDHKTFSI 530
gi 148377433 454 EYVPVFeNAYSFLQVQVPMEFVEDFGLLKIDLLGLKTLTEIKHIEKRISKLklfDELVYEn-------dLELQDPMAINL 526
gi 240047654 457 QLVPTLeSKDGYNQVQFSAEYLEEFSLLKIDLLGLKNLNIVQQILTLIAKE---NHELSFe-------dLPLFDAATNNL 526
gi 291320098 454 EYVPVFeNAYSFLQVQVPMEFVEDFGLLKIDLLGLKTLTEIKHIEKRISKLklfDQLVYEn-------dLELQDPMAINL 526
gi 304373272 460 NYVPTLiSKDKYNQTQFSAEFLEQFSLLKIDLLGLKNLTVVKGIINSINQHsnlNFNFNS---------IPIFDKGTNEL 530
gi 294155789 450 DIAPTYsNSTNLSQIQLPLNFLEDYGLLKIDFLGLKTLSIIKDIEEVIPNElrfDYLYDKn-------eNIFNDKKTFDV 522
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71893932  539 LSQGKTSGIFQLESPGMTASIKKIGVSSINDIIAIISLFRPGPIQQIPTYAKNKERN-NWEKIFPEYDKIVESTFGVIIY 617
gi 15829190  525 LENKSTLGIFQIESPGMTNTINKINVDDFKDIYAAISLYRPGPLKFISVYAKNKKNPkNIKKIIEPYDNIVKDTYGIIVY 604
gi 47459322  529 LSDGNTAGVFQLESPGMIQTIKKVKISKFSDIVDVISLYRPGPMQYIQEYIDNKNDAsKIKHVEKLYDEIVSKTHGIIIY 608
gi 72080910  547 LSQGKTSGIFQLESPGMTASIKKIGVSSINDIIAIISLFRPGPIQQIPTYAKNKERN-NWEKIFPEYDKIVESTFGVIIY 625
gi 54020612  539 LSQGKTSGIFQLESPGMTASIKKIGVSSINDIIAIISLFRPGPIQQIPTYTKNKERN-NWEKIFPEYDKIVESTFGVIIY 617
gi 71894540  531 LNDLKTEGIFQLESDGMKRAISQVKIDSFEDIYAIISLYRPGPSQYIPIYGKNKKDPsQIEKVHPIYDKIVAPTFGIIVY 610
gi 148377433 527 LNNGNTEGLFQIESSGMKSTIKKVGIQSFEDLFAIISLYRPGPKEYIKDYANNRKNPkLIEKIDPVYDEIVAPTYGIIIY 606
gi 240047654 527 LSSGLTSGIFQLESPGMSSTLRGVGVDSIEDVIATISLFRPGPLKQIPIYKQRKNNKiKWESISYEYDQIVAPTYGIIIY 606
gi 291320098 527 LNNGNTEGLFQIESSGMKSTIKRVGIQSFEDLFAIISLYRPGPKEYIKDYANNRKNPkLIEKIDPVYDEIVAPTYGIIIY 606
gi 304373272 531 LTRGKTVGIFQLESPGMANTLRKVGISSIDDVVAVISLFRPGPIKNIPLYAQRKKNEaDYEIISQEYNDILKSTYGIIIY 610
gi 294155789 523 LNSGLTEGIFQLESPGMKSAITKVSIDSFNDLVAIISLFRPGPMQYIDQYANGKKDPkTIKRIHPYYDEIVKDTFGIIVY 602
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71893932  618 QEQIMQICQVVAGFNLEQADIIRVAISKKDETKLDKIKENFIKNGTNLGYEPKLVEDIYNLIYKFSDYGFNKAHAVAYAT 697
gi 15829190  605 QEQIMEIAQKVSGFKFTEADVLRKAISKKDITLLDEMKAKFIQGGIKNGHPKNVVENIYLTIEDFAQYGFNKSHAVAYAV 684
gi 47459322  609 QEQILEIVQKYAGLSYAKADILRRAISKKNSEEIEKFKDLFISSSIQHGQSEKVANEIFSKIENFAQYGFNKSHAVSYAT 688
gi 72080910  626 QEQIMQICQVVAGFNLEQADIIRVAISKKDETKLDKIKENFIKNGTNLGYEPKLVEHIYNLIYKFSDYGFNKAHAVAYAT 705
gi 54020612  618 QEQIMQICQVVAGFNLEQADIIRVAISKKDETKLDKIKENFIKNGTNLGYEPKLVEHIYNLIYKFSDYGFNKAHAVAYAT 697
gi 71894540  611 QEQIMQIAQEVAGLSFSEADLLRRAISKKNSQELKSYKTKFFEGGAKNNVSSDLLNRIYSNIEKFADYGFNKSHAVAYAV 690
gi 148377433 607 QEQIMEIAQAVAKMSFAQADLLRRAISKKNEAELHKYRNTFFEGGLRNNFSIESLTKIYDKIEKFAQYGFNKSHAVSYAY 686
gi 240047654 607 QEQIMQICQQIAGFNLAQADIIRVAISKKDESKLIAIKDSFIEAAIKKGHKLEYIEKIYELIYKFADYGFNKAHAAAYAT 686
gi 291320098 607 QEQIMEIAQAVAKMSFAQADLLRRAISKKNEVELHKYRNTFFEGGLRNNFSIESLTKIYDKIEKFAQYGFNKSHAVSYAY 686
gi 304373272 611 QEQIMQICQTIAGFDFATSDLIRRAISKKEAKKLYKAKQLFIQGGLNKGYSAVVLEKIFQQIEYFAEYGFNKSHAVAYAT 690
gi 294155789 603 QEQIMQIVQKISSMTFSQADLLRRAISKKDEKKLVEMKSSFFEGGIKNNIKKDVLDEIYARIELFADYGFNKSHAVAYSY 682
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71893932  698 LAYKMAYLKAKYPAYFFVELISNENGAQAKIKKYVGEARNFGFKIHRPNINFSTENAVFDKGKntIFLPLLMVKGLGTIA 777
gi 15829190  685 LVYKMLYYKAHYPLFFYSSLIKTNHTNQDNLKTYFLEAKKNNIAFYSPSINNVSEQNILSKNE--MFLPLIMIKGFGPAA 762
gi 47459322  689 TTFYFAQLKANFPLEFYTVLISSSD-SLETINKYVIEAKNNLYTVESPDINVSDFKAFSDFEK--IFLPLIMIKGLGKVA 765
gi 72080910  706 LAYKMAYLKAKYPAYFFVELISNENGAQAKIKKYVGEARNFGFKIHRPNINFSTENAVFDKGKntIFLPLLMVKGLGTIA 785
gi 54020612  698 LAYKMAYLKAKYSAYFFVELISNENGAQAKIKKYVGEARDFGFKIHRPNINFSTENAVFDKGKntIFLPLLMVKGLGTIA 777
gi 71894540  691 LALKLAFYKARYPFIFYKVLLDNSFSSQENTSKYVQEATKLKIKINAADINISSLNTVEENNN--LYLSFLTIKGFGENS 768
gi 148377433 687 LTMKMAYYKARYPQVYFSALISNSYGDQNKIASFVNELKNMNFSVYSPSIIHFTNSAIVDNGD--IYLPFNMIKGLGAES 764
gi 240047654 687 LAYKMAYLKTKFPAQFYSCLISNENGSHENIKKYALEAQKSGFKVCQPDINHSFENATFDLEEklIFLPLTMIKGIGSNY 766
gi 291320098 687 LTMKMAYYKARYPQVYFSALISNSYGDQNKIASFVNELKNMNFSVYSPSIIHFTNSAIVDNGD--IYLPFNMIKGLGAES 764
gi 304373272 691 LAYKMAYLKQNYPLEFYSFLITNEEGSQTNIAKFIKEAQP-AIKFKKPNINISTTSVVYERKTstIYLPLILIKGLGSVA 769
gi 294155789 683 ITYKMAYYKTNYKNVFYRALISNANGTHLTINKYVKEAKSVDISVQSPDINFSKKHAVVINSN--LYLPLNMIKGVGGVA 760
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71893932  778 IKTIIDERSKNGIYKN--FLDFIKRMKLVNFSKVAIEKLIFANTLSDFGNQETLAHNFELLWNHASFVLNDKDGNLVLTT 855
gi 15829190  763 YNKVYKDFQENGLYKS--FDDFIQRAWKMELGKANIETLIKANALREFGNMKDLLTLFKEVIEDKFEIVSKLAKVQGDDI 840
gi 47459322  766 IQKILDERNQNGKYSS--FFTLVARLNFVGITKGILEKLILSNALRNFGSMQTLLANLTQAYAYAETVLFKDENGIEKIN 843
gi 72080910  786 IKTIIDERSKNGIYKN--FLDFIKRMKLVNFSKVAIEKLIFANTLSDFGNQETLAHNFELLWNHASFVLNDKDGNLVLTT 863
gi 54020612  778 VKTIIDERSKNGIYKN--FLDFIKRMKLVNFSKVAIEKLIFANTLSDFGNQETLAHNFELLWNHASFVLNDKDGNLVLTT 855
gi 71894540  769 ATKLIQERNRAGKFKN--FFDAAIRLGMIGIKKATLSLLINANIFRSFGNINTLINSLEDVSNFVDLINKKVKKAFMTLD 846
gi 148377433 765 IKKIALDIKENGQYKDlsLFEILLRLRFAGIKNSMISTLIRANVFRSFGYQD-YIGGVDLLMQEEYNLLSKGANSFADIA 843
gi 240047654 767 IRPLLKEREAKGKYSN--FIDFFLRMKIINFSETLIIKLIKASALASFGSQDSLLASVEIAKNYYPCILEDAKGEKYIDY 844
gi 291320098 765 IKKIALDIKENGQYKDlsLFEILLRLRFAGIKNSMISTLIRANVFRNFGYQD-YISGVDLLMQEEYNLLSKGANSFADIA 843
gi 304373272 770 CQKILEERNKNGLYKD--FLDFVIRMKIINISNTIITLLINSGTLSEFGNIPTLLENLVTAESYKICILEDENKNLYCDY 847
gi 294155789 761 LEKIINTPKDNKKFSS--FFELYLKLRNSGVGESIINALIKSNTFRTYGNVNSLLNSLSIAKNLYETFKLKVSRLKIQDE 838
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71893932  856 DN---------F------GLDLEF-LEKIPYNQEKNYENEVKYLGMSFVDDQNNYLFTNQ-------IRLKD-LRIGNEY 911
gi 15829190  841 DI---------S------NFFQLEfSKNSSRDIEFERKNEEEYLGYFYNSPSQNENSNQNlenedltINLKN-MHPGTEH 904
gi 47459322  844 -----------F------GLSKEHtIVEDKRDLSFEAKNESEYLGMVFNAFPTLKYETK--------NTLNN-LILNIEY 897
gi 72080910  864 DN---------F------GLDLEF-LEKIPYNQEKNYENEVKYLGMSFVDDQNNYLFTNQ-------IRLKD-LRIGNEY 919
gi 54020612  856 DN---------F------GLDLEF-LEKIPYSQEKNYENEVKYLGMSFVDDQNNYLFTNQ-------IRLKD-LRIGNEY 911
gi 71894540  847 KSeqtdgkwisLyedfarEEQFPNiLDEVEISDKEIMDLETKAYGISLSVIDESKVENE--------FSLNS-LNENETR 917
gi 148377433 844 NNldf----egY------KKASENiEMQSKFNLEEESRNEIELLGNIYNAYKTVQYEKKYk------YRLSDlLKMQGSF 907
gi 240047654 845 SQ----------------VFNIPFvLKEVEIDYQQTIKNEIEFLGMQFSKPPIPKALKNQ-------IKLVD-LEANQQY 900
gi 291320098 844 KNldf----egY------KKASENiEMQSKFNLEEESRNEIELLGNIYNAYKTVQYEKKYk------YRLSDlLKMQGSF 907
gi 304373272 848 S-----------------LIPGKFeLEIKEDNLELTIENEEKLLGMSFSSFDQNIDLKNP-------VLLSE-LSLNVEY 902
gi 294155789 839 KIddelvlfikE------NNLLDRkVDIIDRDIETESKYELELLGNTYNTFITSDLEGE--------IKIKN-FPIETET 903
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71893932  912 RLILELKNVIRLR-KA-NSEYFMVILAD-DENEIKIFTKNPDY-LLLETKKH------------YEFIVFFSKPGKFYLK 975
gi 15829190  905 VLDILITQKKSIMtKD-DHLIKRLEFED-DSMKAMSWINEQNE-ENFKDIKVgk---------rYRVEILKPMNQKTFII 972
gi 47459322  898 NVAIIVDKIFISRtKSkNKEYIKLIFSDrTKVVETAIFNDIEK---YRELKDgdilianiimkkYDGLISYSLRPNWRII 974
gi 72080910  920 RLILELKNVIRLR-KA-NSEYFMVILAD-DENEIKIFTKNPDY-LLLETKKH------------YEFIVFFSKPGKFYLK 983
gi 54020612  912 RLILELKNVIRLR-KA-NSEFFMVILAD-DENEIKIFTKNPDY-LLLETKKH------------YEFIVFFSKPGKFYLK 975
gi 71894540  918 NFNVILEEFDVKL----NTNSKKVKIND-GKVSKFAFVSDYSLsIFNKELLNkk--------inVTVTLKKSRSNFKYLL 984
gi 148377433 908 STAIEIIIKKEPK----DKPYAIIEVCD-RTLNYTFFVNKNNL-TKYRALNKgd---------iIEAHIRSNGNKMYLDS 972
gi 240047654 901 SLNLVVNNFALLKsKA-GSSYAKISLSD-FDTQVDVLLFGSKV-SLLEQLKKgs---------iFKFLISKNLKNEFKIY 968
gi 291320098 908 STAIEIVVKKEPK----DKPYAIIEVCD-RTLNYTFFVNKNNL-AKYRTLNKgd---------iIEAHIRSNGNKMYLDS 972
gi 304373272 903 RMVLYVKKVANLTaKT-GASMKKITLTDfQSPDQDIWLFGSKV-TFFEAVKEkq---------yYEFLIIKIKDK--LIL 969
gi 294155789 904 WIVVYVNRLVHVA----KKNIWTVVLSD-SSDEIAIFISENDYdNRFKNLKKnt---------iIKAKLYRSMKNKYYLR 969

                 ....*.
gi 71893932  976 GSPKNC 981
gi 15829190  973 KKIRGI 978
gi 47459322  975 NNSKKG 980
gi 72080910  984 GSPKNC 989
gi 54020612  976 GSPKKI 981
gi 71894540  985 LEKWSL 990
gi 148377433 973 WQGIE- 977
gi 240047654 969 NNKFEE 974
gi 291320098 973 WQGIQ- 977
gi 304373272 970 QNHLKE 975
gi 294155789 970 DWKER- 974
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap